lighttpd-1.4.55-lp151.3.6.1<>,^|t/=„ST6_ʖ>-NMN0k ﭧI?d   V - Fj AFj8j  j j j .j /$j0j2j5x5j7D7'8 ';'(;m8;t%9<%:?3%=>?@FG jHҴjI\jXY\j]j^8bݰcYdeflujv,w jxjy\z`ptClighttpd1.4.55lp151.3.6.1A Secure, Fast, Compliant, and Very Flexible Web ServerLighttpd is a secure, fast, compliant, and very flexible Web server that has been optimized for high-performance environments. It has a very low memory footprint compared to other Web servers and takes care of CPU load. Its advanced feature set (FastCGI, CGI, Auth, Output-Compression, URL-Rewriting, and more) makes lighttpd the perfect Web server software for every server that is suffering load problems.^|tobs-arm-9,bopenSUSE Leap 15.1openSUSEBSD-3-Clausehttp://bugs.opensuse.orgProductivity/Networking/Web/Servershttps://www.lighttpd.net/linuxaarch64/usr/sbin/groupadd -r lighttpd >/dev/null 2>&1 ||: /usr/sbin/useradd -g lighttpd -s /bin/false -r -c "user for lighttpd" -d /var/lib/lighttpd lighttpd >/dev/null 2>&1 ||: test -n "$FIRST_ARG" || FIRST_ARG="$1" # disable migration if initial install under systemd [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$FIRST_ARG" -eq 1 ]; then for service in lighttpd.service ; do sysv_service="${service%.*}" touch "/var/lib/systemd/migrated/$sysv_service" || : done else for service in lighttpd.service ; do # The tag file might have been left by a preceding # update (see 1059627) rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -e "/usr/lib/systemd/system/$service" ]; then touch "/run/rpm-lighttpd-update-$service-new-in-upgrade" fi done for service in lighttpd.service ; do sysv_service="${service%.*}" if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --save $sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" -a -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -eq 1 ]; then if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl preset lighttpd.service || : fi elif [ "$FIRST_ARG" -gt 1 ]; then for service in lighttpd.service ; do if [ ! -e "/run/rpm-lighttpd-update-$service-new-in-upgrade" ]; then continue fi rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -x /usr/bin/systemctl ]; then continue fi /usr/bin/systemctl preset "$service" || : done for service in lighttpd.service ; do sysv_service=${service%.*} if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --apply $sysv_service || : touch /var/lib/systemd/migrated/$sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable lighttpd.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop lighttpd.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart lighttpd.service ) || : fi else # package uninstall for service in lighttpd.service ; do sysv_service="${service%.*}" rm -f "/var/lib/systemd/migrated/$sysv_service" || : done if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi fi5w@iUfF</P{}O` `X   @  ( p  @   P   ` 0z 5_.JzL &P K~.VQ Np&nAA聠A聠AA큤AAAAA^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|a^|b^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|c^|p^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^|a^|`^|`^|a^|a^|a^|a^|af45d09334766ce774c9dc90f00a1a645fa64de14e222e647a464c4307a4976d9aec61660e6a34dba4079420341e09353746888da8dcda0c1e5f8b0f57488d8c86ab9a143eeb02c106754b8c5e38685ef29adb774483e1dcfb8a482d65e8cba005615542e73a99e25cecf6da6db128046476907d046319bf35441e8ea67c7df5e44e10f874c6aa9717af0be89eec4dbfd3747e92fa2572d42b18cb17ca35c48f9e67fa1c23d311c01d678c65dc971e4ef6988a8dc6379c30846a69a20f4448c31395adfcd8c07307816fb6a0541a11091e2f1b599d61192a1e4ae0354d5cc4dfb3eb9f7bd00fa03269ee834f1fe22c0f9a16b06a64745baa74ed521dcae7df7cd74b3906e82498ada1ffc02d5d2b145f502aaf191ba9189fe13c014dcc61f5f7509d6405336b5881a03ab9408ca17e57697ba10ac9638704774ac1b6ad32e89271d50c95afdc2ce1bd53e2817a2edab374ab73ba0011f769994da167cd6e6db7122ce54a7a4cf8b8e52ce06a5b485a0e444e67865ad044f68e8262d9708e6cfd25caf0df87385952b4800edb4ed7113bae33a668b27945ec9335ee80edf6949db7dae00d74566f9ac7713a4e251d789191bc662003bcee7e5ff568a2b135ee0163865c44af5f71df24e05171a6a70b1d8daa0e0c2c379d508d4bc36ac7c36f1de3cf5ac7ed07301a8affc51bc3bedb623f49c2f561bc0796766a7cfad6a7a46ac0a481920acb16c6baeb564d9e1c17b2ac84bb79ecbfc06227cffb6f9bbcde7f0e4b410a368c42aa45556d8987870f112bbe7539fa8e0cb5285a7b34ba43e3b92d1a07df97e931e98a76f2c18e51f69197c0744d24b555cd474c4f9b04e008d9a764f9f1735e6d3e8acb3b5d9ed5facf6120dc18ef6aae512e964f4444c3761e4c41e60fbb6c36fb48146882dd278a9a3f158d7aee074190e4eaacd0ac0f455322037d1bd92c0451d4c9c10a8aaa08d48d99081befb74cf6dc71c9106de825f1435ea2859925d3e5afae2332cebcb7951531d65602c8411839bd015495285b98df322028ee9b4db6f837f0d9769b3fe7985716a120fd10e0bff77582fd66e859df064cf46d1f646532b0f34f88460da6925d4319de348cc67be3b016bd2ea456da5c94fce8f9900c3f6b22987547183fde54a99a0c3f032776e92ac5819eb76ee052f9a0f2d422df637c7883c21c6c26b0a99e5896ef0d52d031779672e09ec134e2997760a7a879eb0d15ac985f7716e0630d9cfbeb06543f0c200cfd9f24bd53b6400a3573f420398956b5ba31d4cba0416a9036ca98dfe16ebae598473a6c5ab2b742511b5838ed5771fae8f43b6b19011d0cefde4fe6810f1b0fa16aa4f48998f88f7a39bb51a7d2e71fb198fe8aff01397c304d3749fd05c9d087ac3e3d9bf89292d141523387e51fad8f91ecfdf28234fa8b3be410bf0d31ef69722233fffa0fd77ac31f43b3ea58fd9decc1e983583ae16601235198d62a1df48d2ceab9c7ed68175e9b61c11a182cbacb1b280de855f53d349b1c18e9a69e3ecb119c4cc772634c9671348a66f9ceadd644ee778ce2d3060c6c495fb1545ba3bbdca8fd44649661117f09dd5800dc953ac9ac22ea9c96f47bcb98d84c8ca4eb2e78647eb55bb49a72e118f7ac371eaaf4761ce4405ce081d8535de505f4064bc810809b596e20c1025ae66bd4e45ddbaf4069ec758fc25f96c9f523071348b244f9b2b339f523b27a4e866ba9a2f833a095666ba9f099f153d02775f850ff04fc383c7e914574cc1acae2f6acca1d0e75548da7e7f12dd4c4bac45b2e33e0cf19fbcdcac2cb48d3b6b18eed64e4419cb766588b1319e13c7b6cb020a1021f5ab1e06e01c605a599b28f47d3c3480571ffb9535f221f51e085d36ed9e2165236f95ff082ef3e4718ca51bb4cab7c647f4301dc2b3dc34206d062516ef9655ad1cfee6df63995294f43d593126977dc4a3fdf426c7646dbfecfbf07ceb807b76abbd55e23556c27d4b521285a82605cfcecd56631550b77b0bd7708ecd5056766617e69526dfe45f0cfc91fb667e65129d804785f79bcba6046478c03634a511fcbdde7ead819d4cfa715bdc100fb77e10f8bacd7219baa0ec67eccc2d2fb3dba802f18d3878eaa29132b881597ef56f7fbf6617c998b62d3e25e0a17a110ca76a6df2200d87dd0e33dbc69d0f4f3be7c4b295a8163ed8f8737ebec5933fd7c06ec113ff5723b4a4033b1f78fa819c94830a9914fc1d8c7000c26cbd8f59f0aa67a505e5553180d55c3bc7f7c41593af3a8b0218c588c40fd13932143888ff2e958a45113c9f6121a7437bea2f863b76a7e0a82fed2b178e4e95256e5ecaccbacd0d3fd31d74417d6d4ae42651720ece94d9d5ea838efedd45a5837358957a96a2a52e93f42ea453f47897c3c9e8099019a5b68807df017a28aee1b159d027d263270d42d8e05510ab9cad50b89f43f1416bd645b699454a344f9f99c8d7722bed9db3515e7b28e3b0bfa464808f0f415993ace6aad48292bd7d5459440c2ae9bb13f64644d4d602afd0d569fd720daa75f0ae018ed465bbf2949321c4af89c05a19511f644af919d18e7268d98ddfcde7cf47eea08ee202a64951cad2b7d220bf7b95a10603dddbfb7276250b2c603c1bdafd57fdb95068f5202e19bd76bf3848edd3c2824e141cd63c0e7a0c653b3d3c34dbc1d9f09f99c57c8b57e70c07a70aa419f3762568e47db2e54b6e636544f054239984eabf9269311f0eee78cb0e39198aea24ac61a4dc4d05d70eaee89a94d12d4b7d868ec0a22273ab5462a906d229962cf55ae4d7eb2bc6e611f009667e2dd0cca3398c3979cbd5ae54d3d193afc07e164c1056b9221db1bf4c10a41402bb0a9453f814360f6a67863c195dacb44785b1f387e664325e981ce1db887cddee41b99915fbb47e7ae430ffef1c30c88218478e51b4c826e58c18a48cffa96e5a510e2bd05000d2cb076fa3322b0f5645fc2e46dde49bb7f3b1ff4aecb6ce388c610f25618c410b3313050fd5ca11a8c7f7dc0d8784f48ca50de8fdd7cc384d50204523f7aa541ab4480ea5154e71b2b6c2e974139fc1a5d4e9225e11e47764329a402a0051373a50e23216c5f3fb49c4cbcd1c0b5c3ef283fca9ada4d69aa83309c5139377b76e0abdc30e78ecf531c18d3177564a071a51c69df1bff4c34ef6115be29ddfac2335a3b53c8d318e532784b3e8ca86f118f333b49c07a1748e8812b2d1499c30904ad40c57b6ecfd36cb8cfb621054db8c5bc6e36ef10f23a1ec6d0667bc2032f7bab5d7101322041ef85a0256f0da59b3b32172841f272c6cdbda9223450827b0bf97a4d642870f4313cb2fafa12b4b6ec12972305b30546c9ea5c759411bd869885e5fe1dd216bf228dd1ae25299868c24f3baf8ce1172f29487724fd7f257d7e5540a2df25b52d32dafa7b02119e00cab53851facfef4d2681ef49ec0cc388c2448f84411e5e21badac7ab6dc1ab5926f4c0df9d1c7a8c4fe685feb4e15911b0b646fd40a29ec2afb7c818853631fbede70454c3d9e0e97a3e4491e80fcc3b00cc853d2726d940328e30967474c29f243fd140d51fdc5361c75e56059d03a520030d171558366263815a658ae3db848a8feac19b9e4b264a64be0b5e1b7e7ba58398ab0567c4ba317d7dbb1e4742323773f34caea9f1baa28b34192589434685887ad18efde3a5cd89a3342eb2ac783e253ac404c6d8b6b435e1422bdf0bbe3a4992ff25610181f7e3fa22d540f1940729bc6721839dc9d364b8d4c9629e472b09d9f42b8f1aa99e17e2f48a756a0d9732306b4d13dc563a1e08aecfb5063b0fbb18a0f85e7d5d9250a180a93ee36bb70637a7b0e74d7d8b14ae8a475d98e28cf8f1f127cc3e3ecfb1c8b4ddc32bc6f987ca9f4bec792d4835b4457a70b3679ba18748ffbd0a38c62bd082261305a4f7b1ae9d61246c2b21680adfd675eb5ff3730db086f33c5cb14e558422ca504e4e8899575bc02a4bef009aee00fbf47f1ecd1dfcadd993b5194ddbef469649bb8df455751b644432cd79a5810fe03b94bcc227fb23a98c7c545c5d696d600e332ccaaa5831371be437031332b716d8f45fde44137e5ae30c2f1fe59171f49be53bb2c412a430f9d5e253b65594fefb5367ca7bc974ecb7e877463d40a459d97035861604381019b1ec47d5163ecfb56f406f4592182cdc53f2477d2192f09e73cdd947ec8ad37328afcaa4ff2e5315ce014c8ef8a87934589ec7123293a191566ddfa4a575f142d2e26db998622d95d5badd886e4c63a0f0c73e397servicerootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpd-1.4.55-lp151.3.6.1.src.rpmconfig(lighttpd)http_daemonhttpdlighttpdlighttpd(aarch-64) @@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/sh/bin/sh/bin/shconfig(lighttpd)coreutilsdiffutilsfillupgrepld-linux-aarch64.so.1()(64bit)ld-linux-aarch64.so.1(GLIBC_2.17)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.25)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(GLIBC_2.17)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libev.so.4()(64bit)libfam.so.0()(64bit)libpcre.so.1()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libz.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)shadowspawn-fcgisystemdsystemdsystemdsystemd1.4.55-lp151.3.6.13.0.4-14.6.0-14.0-15.2-14.14.1^b;@^6]]@Z@Zb@Za@Za@Zx@Z@Z7Y+@Y@Y@XCX|XzXzXs{@X^c@X2@X2@XkW@W!VU@U@UȒ@UU@UUTTTT\@T_W@Vítězslav Čížek Andreas Stieger Andreas Stieger Dominique Leuenberger dimstar@opensuse.orgi@marguerite.sumikhail.kasimov@gmail.commikhail.kasimov@gmail.comjenkins@lighttpd.netrbrown@suse.comstbuehler@web.destbuehler@web.destbuehler@web.demrueckert@suse.demrueckert@suse.debwiedemann@suse.comstbuehler@web.dejenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netdimstar@opensuse.orgjenkins@lighttpd.netmrueckert@suse.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.detchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comLed - Remove deprecated GeoIP support (bsc#1156198) * drop mod_geoip subpackage- update to 1.4.55: * a multitude of bug fixes- update to 1.4.54 (boo#1111733): * behavior change: strict URL parsing and normalization (configurable) * performance enhancements * bug fixes - includes changes from 1.4.53: * TLS-ALPN-01 * systemd socket activation * bug fixes - includes changes from 1.4.52: * performance enhancements * bug fixes - includes changes from 1.4.51: * new module: mod_authn_pam * multiple security fixes + process headers after combining folded headers + mod_userdir security: skip username "." and ".." - includes changes from 1.4.50: * CVE-2018-19052: path traversal in mod_alias (boo#1115016) * security: use-after-free after invalid Range request * multiple bug fixes - Fix build with PostgreSQL 11 in Tumbleweed (boo#1153722) - Switch to unmodified upstream tarball, add upstream signing keys and verify source signature- BuildRequire pkgconfig(systemd) instead of systemd: allow OBS to shortcut the build queues by allowing usage of systemd-mini- Revert that pgsql workaround for tumbleweed: pampering over issues like this is just hiding problems. A real fix was submitted to the postgresql package instead.- workaround for tumbleweed * update-alternatives not expanded in the build VM due to unknown reasons, thus /usr/bin/pg_config is meaningless- Updated 10-ssl.conf (TLSv1.2 only) for lighttpd.conf in lighttpd_1.4.49-1.1.debian.tar.xz- Updated 'SSL Support' section in lighttpd.conf: TLSv1.2 only bsc#1087369- update to 1.4.49 + - next is 1.4.49 + [core] adjust offset if response header blank line + [mod_accesslog] %{canonical,local,remote}p (fixes #2840) + [core] support POLLRDHUP, where available (#2743) + [mod_proxy] basic support for HTTP CONNECT method (#2060) + [mod_deflate] fix deflate of file > 2MB w/o mmap + [core] fix segfault if tempdirs fill up (fixes #2843) + [mod_compress,mod_deflate] try mmap MAP_PRIVATE + [core] discard from socket using recv MSG_TRUNC + [core] report to stderr if errorlog path ENOENT (fixes #2847) + [core] fix base64 decode when char is unsigned (fixes #2848) + [mod_authn_ldap] fix mem leak when ldap auth fails (fixes #2849) + [core] warn if mod_indexfile after dynamic handler + [core] do not reparse request if async cb + [core] non-blocking write() to piped loggers + [mod_openssl] minor code cleanup; reduce var scope + [mod_openssl] elliptic curve auto selection (fixes #2833) + [core] check for path-info forward down path + [mod_authn_ldap] auth with ldap referrals (fixes #2846) + [core] code cleanup: separate physical path sub + [core] merge redirect/rewrite pattern substitution + [core] fix POST with chunked request body (fixes #2854) + [core] remove unused func + [doc] minor update to *outdated* doc + [mod_wstunnel] fix for frames larger than 64k (fixes #2858) + [core] fix 32-bit compile POST w/ chunked request body (#2854) + [core] add include sys/poll.h on Solaris (fixes #2859) + [core] fix path-info calculation in git master (fixes #2861) + [core] pass array_get_element_klen() const array * + [core] increase stat_cache abstraction + [core] open additional fds O_CLOEXEC + [core] fix CONNECT w strict header parsing enabled + [mod_extforward] CIDR support for trusted proxies (fixes #2860) + [core] re-enable overloaded backends w/ multi wkrs + [autoconf] reduce minimum automake version to 1.13 + [mod_auth] constant time compare plain passwords + [mod_auth] check that digest realm matches config + [core] fix incorrect hash algorithm impl + [doc] NEWS- Replace references to /var/adm/fillup-templates with new %_fillupdir macro (boo#1069468)- new upstream release 1.4.48 + requires automake 1.14 + new mod_authn_sasl module - remove autoreconf call; was required for mod_geoip patch, which is now upstream - add cyrus-sasl-devel, package mod_authn_sasl- update to 1.4.47 + [core] stricter validation of request-URI begin + [core] fix 1.4.46 regression in config match + [core] normalize config addrs for != match + [core] normalize config addrs for eq and ne + [core] fix 1.4.46 regression in Last-Modified- new upstream release 1.4.46 - drop lighttpd-1.4.x_out_of_bounds_read.patch (fixed upstream) - use systemd, drop init script - drop support for suse_version <= 1210 - add some new modules and packages - drop __DATE__/__TIME__ sed hack (usage disabled upstream by default)- use php7 for TW (boo#1058101)- added lighttpd-1.4.x_out_of_bounds_read.patch: fix out of bounds read in mod_scgi (debian#857255)- make lighttpd user own /var/log/lighttpd/ to be able to write logs there- fix some rpmlint messages + update FSF address for lighttpd.init + install example scripts without +x to avoid pulling shell dependencies + W:file-contains-current-date /usr/sbin/lighttpd is a false positive; it only happens when the last-source-modified date is the same as the build date + I: binary-or-shlib-calls-gethostbyname has been forwarded upstream- update to 1.4.45 + - next is 1.4.45 + [mod_cgi] skip local-redir handling if to self (fixes #2779, #2108) + [mod_webdav] fix crash when plugin_ctx cleaned up (fixes #2780) + [mod_fastcgi] detect child exit, restart proactively + [mod_scgi] detect child exit, restart proactively + [TLS] ssl.read-ahead = "disable" for low mem (fixes #2778) + [doc] NEWS + [tests] update test skip count for !fcgi-responder + [tests] FCGI_Finish() final request before exit + [tests] give time for periodic jobs to detect exit + [mod_cgi] check cgi fd for num bytes ready to read- lighttpd-1.4.13_geoip.patch is long gone; it was replaced with mod_geoip-for-1.4.39.patch but is now included upstream- update to 1.4.44 + - next is 1.4.44 + [mod_scgi] fix segfault (fixes #2762) + [mod_authn_gssapi] fix memory leak + [config] warn if mod_authn_ldap,mysql not listed + [mod_magnet] fix magnet_cgi_set() set of env vars (fixes #2763) + [mod_cgi] FreeBSD 9.3/MacOSX does not have pipe2() (fixes #2765) + [mod_extforward] fix crash on invalid IP (fixes #2766) + [mod_fastcgi] fix segfault if all backends down (fixes #2768) + [mod_cgi] fix out of sockets error for POST to CGI (fixes #2771) + [mod_auth] compile fix for Mac OS X XCode (fixes #2772) + [mod_authn_gssapi] better resource cleanup + [core] compile fix for Mac OS X 10.6 (old) (fixes #2773) + fix race in dynamic handler configs (reentrancy) (fixes #2774) + [mod_authn_mysql] close mysql_conn in cleanup + [mod_webdav] compile fix when locking not enabled + load mod_auth & mod_authn_file in sample/test.conf + comment out auth.backend.ldap.* in tests/*.conf + [mod_fastcgi,mod_scgi] warn if invalid "bin-path" + RAND_pseudo_bytes() is deprecated in openssl 1.1.0 + openssl 1.1.0 init and cleanup + [mod_cgi] remove direct calls to network_backend* + [build] build network_*.c into lighttpd executable + suggest inclusion of mod_geoip... before mod_ssi. + set systemd settings similar to lighttpd2 + [doc] remove reference to Linux rt-signals + [mod_authn_gssapi] fix missing error ret, coverity + [core] rename li_rand() to li_rand_pseudo_bytes() + remove #include "stream.h" where not used + [mod_cml] include lua headers before base.h + [core] combine duplicated connection reset code + [mod_ssi] produce content in subrequest hook + [core] remove srv->entropy[] + [core] defer li_rand_init() until first use + [core] permit connection-level state in modules + [mod_dirlisting] render dirlisting as HTML (fixes #2767) + [mod_proxy] replace HTTP Host sent to backend (fixes #2770) + [mod_ssi] basic recursive SSI include virtual (fixes #536) + [mod_ssi] implement, ignore + [core] consolidate duplicated read-to-close code + [core] fix segfault when parsing a bad config file + [core] support Transfer-Encoding: chunked req body (fixes #2156) + [autobuild] set NO_RDYNAMIC=yes for midipix + [mod_proxy] proxy.balance = "sticky" option (fixes #2117) + [mod_secdownload] warn if SHA used w/o SSL crypto + [build] compile fixes for AIX + [build] check for pipe2() at configure time + [mod_evhost] fix an incorrect error trace + [tests] mark tests/docroot/www/*.pl scripts a+x + [mod_proxy] proxy.replace-http-host enable/disable + [mod_cgi] fall back to pipe() if pipe2() fails + fix SCons fullstatic build with glibc pthreads + [TLS] openssl 1.1.0 makes SSL_OP_NO_SSLv2 no-op + [doc] NEWS- update to 1.4.43 + - next is 1.4.43 + [autobuild] remove mod_authn_gssapi dep on resolv + [mod_deflate] ignore '*' in deflate.mimetypes + minor: make packdist.sh more convenient for me + [autobuild] omit module stubs when missing deps + [autobuild] rm module stub code for missing deps + [TLS] openssl 1.1.0 hides struct bignum_st + [autobuild] move http_cgi_ssl_env() for Mac OS X (fixes #2757) + [core] use paccept() on NetBSD (replace accept4()) + [TLS] remote IP conditions are valid for TLS SNI (fixes #2272) + [doc] lighttpd-angel.8 (fixes #2254) + [cmake] build fcgi-auth, fcgi-responder for tests + [mod_accesslog] %{ratio}n logs compression ratio (fixes #2133) + [mod_deflate] skip deflate if loadavg too high (fixes #1505) + [mod_expire] expire by mimetype (fixes #423) + [mod_evhost] partial matching patterns (fixes #1194) + [mod_evhost] mod-evhost.t tests (#1194) + build: use CC_FOR_BUILD for lemon when cross-compiling + [lemon] standalone; remove #include "first.h" + [mod_dirlisting] config header and readme files + [config] warn if mod_authn_ldap,mysql not listed + fix FastCGI, SCGI, proxy reconnect on failure + [core] network_open_file_chunk() temp file opt + [mod_rewrite] add more info in error log msg + [core] fix fd leak when using libev (fixes #2761) + [core] fix potential streaming tempfile corruption (fixes #2760) + minor: coverity comments + [mod_scgi] fix prefix matching to always match url + move script to doc/scripts/ax_prog_cc_for_build.m4 + [autobuild] adjust Makefile.am for FreeBSD + [core] check fcntl O_APPEND succeeds w/ mkstemp() + [doc] NEWS + [autobuild] add lemon.c to src/Makefile.am + [autobuild] build fix for lemon.c + [autobuild] put ax_prog_cc_for_build.m4 in top directory + [scons] workaround FreeBSD11 fullstatic link error + [scons] only apply FreeBSD11 workaround on FreeBSD + [mod_cgi] FreeBSD 9.3 does not have pipe2() + [build] move some build scripts to scripts/ + [autotools] fix configure.ac for opensuse 13.2 + [build] fix warning for (potentially) unused func- package new modules - remove mod_geoip_for_1.4.40.patch- update to 1.4.42 + - next is 1.4.42 + [TLS] SSL_shutdown() only if handshake finished + [mod_proxy,mod_scgi] shutdown remote only if local (#2743) + [core] check if client half-closed TCP if POLLHUP (#2743) + [core] enforce wait for POLLWR after EINPROGRESS (fixes #2744) + [core] do not enter handler twice after read body + [core] proxy,scgi omit shutdown() to backend (fixes #2743) + [mod_dirlisting] dirlist does not handle POST + [mod_dirlisting] js column sort for dirlist table (fixes #613, fixes #2315) + [mod_auth] Digest auth fails after rewrite (fixes #2745) + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] extensible interface for auth backends + [mod_auth] extensible interface for auth backends + [core] better DragonFlyBSD support (fixes #2746) + [mod_auth] include base.h for USE_OPENSSL def + [mod_auth] support CRYPT-MD5-NTLM algorithm (fixes #1743) + [mod_auth] terminate salt for CRYPT-MD5-NTLM + [core] fix crash if ready events on abandoned fd (fixes #2748) + fix mis-cast in unused code + [mod_auth] http_auth_md5_hex2bin() + [mod_auth] remove empty mod_auth.h + [mod_auth] mod_authn_mysql.c MySQL auth backend (fixes #752, fixes #1845) + [mod_cgi] permit CGI exec of unreadable files (fixes #2374) + [mod_uploadprogress] add to default build + [mod_geoip] add to default build (fixes #2705, fixes #2101, fixes #2092, fixes #2025, fixes #1962, fixes #1938) + [mod_fastcgi] Authorizer support with Responder (fixes #321, fixes #322) + [tests] test coverage for issues (#321, #322) + dynamic handlers store debug flag in handler_ctx + [mod_fastcgi] allow authorizer, responder for same path/ext (#321) + backport mod_deflate to lighttpd 1.4 (fixes #1824, fixes #2753) + [autobuild] test_configfile might need vector.c (fixes #2752) + remove unused sys-mmap.h from stat_cache.c + [mod_deflate] fix longjmp clobber compiler warning + remove unused array type TYPE_COUNT data_count + [mod_auth] structured data, register auth schemes + [mod_auth] mod_authn_gssapi Kerberos auth backend (fixes #1899) + silence warnings from clang ccc-analyzer + [autobuild] skip two new tests if no fcgi-auth + [SCons] define with_krb5 for SCons build + [SCons] fix syntax error in SConstruct + [SCons] define with_geoip for SCons build + [CMake] fix clang -Wcast-align warnings in lemon.c + remove excess initializers (fix compiler warnings) + fix errors detected by Coverity Scan + performance: use Linux extended syscalls and flags + [mod_scgi] add uwsgi protocol support + [mod_auth] refactor LDAP code into smaller funcs + [mod_auth] HTTP Basic auth backends also do authz (#1817) + [mod_auth] ldap filter subst user for multiple '$' (fixes #1508) + [mod_auth] permit specifying ldap DN; skip search (fixes #1248) + [autobuild] update module/feature report + [cmake] build mod_authn_gssapi if WITH_KRB5 + DragonFlyBSD defines __DragonFly__ (#2746) + [mod_auth] fix printing of IP in error trace + quiet coverity warning + [mod_mysql_vhost] support multiple '?' replacement (fixes #2163) + [core] make server.max-request-size scopeable (#1901) + [core] server.max-request-field-size (fixes #2130) + [core] optional condition in config "else" clause (fixes #1268) + [core] restrict where config "else" clauses occur (#1268) + silence warnings from clang ccc-analyzer + consistent, shared code to create CGI env + [TLS] replace env entries in https_add_ssl_entries + [TLS] set SSL_CLIENT_M_SERIAL w/ client cert SN (fixes #2268) + [TLS] set SSL_CLIENT_VERIFY w/ client cert (#1288, #2693) + [TLS] set SSL_PROTOCOL, SSL_CIPHER* (fixes #2511) + [core] rand.[ch] to use better RNGs when available + [mod_cgi] fix pipe_cloexec() when no O_CLOEXEC + ignore return value from fcntl() FD_CLOEXEC + silence warnings from clang ccc-analyzer + fix SCons build + build w/o compiler warnings if no zlib or bz2lib + parallelize dist package build (packdist.sh) + [doc] NEWS + quiet coverity warning + add random() to list of rand() fallbacks- update to 1.4.41 + - next is 1.4.41 + remove long-deprecated, non-functional config opts + [config] inherit server.use-ipv6 and server.set-v6only (fixes #678) + [build] allow AUTHOR, KEYID overrides to packdist + [mod_auth] fix Digest auth to be better than Basic (fixes #1844) + [doc] update memcache references to memcached + [mod_ssi] fix #config sizefmt="bytes" + fix some warnings reported by cppcheck + workaround clang compiler warning + [autobuild] move inet_pton detection later + [core] #include for FIONREAD (fixes #2726) + [autobuild] clock_gettime() -lrt with glibc < 2.17 + minor: spelling changes in some comments/messages + [security] do not emit HTTP_PROXY to CGI env + [build_cmake] clock_gettime() -lrt w/ glibc < 2.17 (fixes #2737) + [core] avoid spurious trace and error abort + [core] stay in CON_STATE_CLOSE until done with req + [core] $HTTP["remoteip"] must handle IPv6 w/o [] + [mod_status] show keep-alive status w/ text output (fixes #2740) + do not set REDIRECT_URI in mod_magnet, mod_rewrite (#2738) + revert 1.4.40 swap of REQUEST_URI, REDIRECT_URI (fixes #2738) + [core] permit IPv6 address scope identifier + [core] consolidate duplicated response_end code + [TLS] better handling of SSL_ERROR_WANT_READ/WRITE + [TLS] read all available records from SSL_read() + [core] try AF_INET after AF_INET6 if use-ipv6 + [core] fix result copy from getaddrinfo() + [core] set chunkqueue tempdirs at startup + [core] check if EAI_ADDRFAMILY is defined + [core] set chunkqueue tempdirs at startup /var/tmp + [security] ensure gid != 0 if server.username set (fixes #2725) + [security] disable stat_cache if !follow-symlink (fixes #2724) + [core] fix buffer_copy_string_hex() assert (fixes #2742) + fix buffer.c comments to match encoded_chars_* + [security] encode quoting chars in HTML and XML + [cmake] always define _GNU_SOURCE + [cmake] enable warnings for GCC and Clang + [cmake] set cmake_minimum_required to 2.8.2 + [doc] NEWS- update to 1.4.40 + - next is 1.4.40 + [mod_ssi] enhance support for ssi vars + add handling for lua 5.2 and 5.3 (fixes #2674) + use libmemcached instead of deprecated libmemcache + add force_assert for more allocation results + cleanup dead keyvalue code + [autobuild] fix lua configure error handling + [mod_cgi] use MAP_PRIVATE to mmap temporary file instead of MAP_SHARED (fixes #2715) + [core] do not send SIGHUP to process group unless server.max-workers is used (fixes #2711) + [mod_cgi] edge case chdir "/" when docroot "/" (fixes #2460) + fix links to online docs in template config files + [mod_cgi] issue trace and exit if execve() fails (closes #2302) + [configparser] don't continue after parse error (fixes #2717) + [core] never evaluate else branches until the previous branches are aready (fixes #2598) + [core] fix conditional cache handling + [core] improve conditional enabling (thx Gwenlliana, #2598) + [buffer] use explicit integer promotion to make the code more readable + [config] extend duplicate-array-key error (fixes #2704) + [mod_compress] case-insensitive content-codings (fixes #2645) + [plugins] don't include dlfcn.h if not needed (fixes #2548) + [mod_fastcgi] 404 for X-Sendfile file not found (fixes #2474) + [mod_cgi] send 500 if CGI ends and there is no response (fixes #2542) + [mod_cgi] consolidate CGI cleanup code + [mod_cgi] simplify mod_cgi_handle_subrequest() + [mod_cgi] kill CGI if fail to write request body + [mod_proxy] use case-insensitive comparision to filter headers, send Connection: Close to backend (fixes #421) + [mod_dirlisting] dir-listing.hide-dotfiles = "enabled" by default (fixes #1081) + [mod_rewrite] fix return type of process_rewrite_rules + [mod_secdownload] fix buffer overflow in secdl_verify_mac (reported by Fortify Open Review Project) + [mod_fastcgi,mod_scgi] fix leaking file-descriptor when backend spawning failed (reported by Fortify Open Review Project) + [core] improve array API to prevent theoretical memory leaks + [core] rename variable in array.c + [core] refactor array search; raise array size limit to SSIZE_MAX + [core] fix memory leak in configparser_merge_data + [core] provide array_extract_element and use it + [core] configparser: error on duplicate keys in array merge (fixes #2685) + [core] more careful parse of $SERVER["socket"] config str (prepare #2204) + [core] accept $SERVER["socket"] without port, use server.port as fallback (fixes #2204) + [mod_magnet] define lua_pushglobaltable (for lua5.1) and use it (fixes #2719) + [ssl] support disabling ssl.verifyclient.activate in SNI callback (fixes #2531) + restart (some) syscalls after SIGCHLD interrupted them; should fix LDAP problems (fixes #2464) + [core] log remote address on request timeouts (fixes #652) + [autobuild] use AC_CANONICAL_HOST instead of AC_CANONICAL_TARGET (fixes #1866) + [core] fix request_start in keep-alive requests to mark time when received first byte (fixes #2412) + [core] truncate pidfile on exit (fixes #2695) + consistent inclusion of config.h at top of files (fixes #2073) + [autobuild] include first.h in make dist + [core] add generic vector implementation + [core] replace array weakref with vector + [base64] fix crash due to broken force_assert + [unittests] add test_buffer and test_base64 unit tests + [base64] fix another crash due to broken force_assert conditions + [buffer] refactor buffer_path_simplify (fixes #2560) + [http_auth/mod_fastcgi] check get_http_*_name() for NULL return (#2583) + validate return values from strtol, strtoul (fixes #2564) + add NEWS entry for previous commit + [mod_ssi] Add SSI vars SCRIPT_{URI,URL} and REQUEST_SCHEME (fixes #2721) + [config] warn if server.upload-dirs has non-existent dirs (fixes #2508) + [mod_proxy] accept LF delimited headers, not just CRLF (fixes #2594) + [core] wait for grandchild to be ready when daemonizing (fixes #2712, thx pasdVn) + [core] respond 411 Length Required if request has Transfer-Encoding: chunked (fixes #631) + [core] fixed the loading for default modules if they are specified explicitly + [core] lighttpd -tt performs preflight startup checks (fixes #411) + [stat] mimetype.xattr-name global config option (fixes #2631) + [configparser] fix small leak on config failure + [mod_webdav] allow Depth: Infinity lock on file (fixes #2296) + [mod_status] use snprintf() instead of sprintf() + pass buf size to li_tohex() + use li_[iu]tostrn() instead of li_[iu]tostr() + [stream] fstat() after open() to obtain file size + [core] clean up srv before exiting for lighttpd -[vVh] + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (fixes #319) + [mod_cgi] always set QUERY_STRING (fixes #1339) + [mod_auth] send charset="UTF-8" in WWW-Authenticate (fixes #1468) + [mod_magnet] rename var for clarity (fixes #1483) + [mod_extforward] reset cond_cache for scheme (fixes #1499) + [mod_webdav] readdir POSIX compat (fixes #1826) + [mod_expire] reset caching response headers for error docs (fixes #1919) + [mod_status] page refresh option (fixes #2170) + [mod_status] table w/ count of con states (fixes #2427) + [mod_dirlisting] class for dir (fixes #2304) + skip spawning backends for preflight tests (#2642) + [core] define __STDC_WANT_LIB_EXT1__ (fixes #2722) + [core] setrlimit max-fds <= rlim_max for non-root (fixes #2723) + [mod_ssi] config ssi.conditional-requests + [mod_ssi] config ssi.exec (fixes #2051) + [mod_redirect,mod-rewrite] short-circuit if blank replacement (fixes #2085) + [mod_indexfile] save physical path to env (fixes #448, #892) + [core] open fd when appending file to cq (fixes #2655) + [config] server.listen-backlog option (fixes #1825, #2116) + [core] retry tempdirs on partial write, ENOSPC (fixes #2588) + untangle overly complex control flow logic + defer reading request body until handle subrequest (fixes #2541) + mv funcs from connections.c to connections-glue.c + defer reading request body until handle subrequest + always poll for client POLLHUP/POLLERR events (fixes #399) + remove handle_joblist hook + handlers can read response before sending req body (fixes #131, #2566) + [mod_cgi] asynchronous send of request body to CGI + improve dynamic handler control flow logic + [doc] add mimetype.use-xattr to conf.d/mime.conf + [doc] enhance error msg for backend server config + [doc] add ref to RFC 7232 for conditional requests + make (compile and link) cleanly under cygwin + [core] compile with upcoming openssl 1.1.0 release (fixes #2727) + fix some warnings reported by static analysis tool + [core] set REDIRECT_STATUS to error_handler_saved_status (fixes #1828) + remove unused con->error_handler member + [core] server.error-handler new directive for error pages (fixes #2702) + set REDIRECT_URI in mod_rewrite, mod_magnet + [doc] add server.error-handler + server.error-handler new directive for error pages + [core] support IPv6 in $HTTP["remote-ip"] CIDR cond match (fixes #2706) + [doc] NEWS + [core] http_response_send_file() shared code (#2017) + [mod_fastcgi] use http_response_xsendfile() (fixes #799, fixes #851, fixes #2017, fixes #2076) + [mod_scgi] X-Sendfile feature (fixes #2253) + [mod_cgi] X-Sendfile feature (fixes #2313) + [mod_cgi,mod_fastcgi,mod_scgi] X-Sendfile features + [mod_webdav] lseek,read if fs can not mmap (#2666, fixes #962) + [mod_compress] use mmap and trap SIGBUS (#2666, fixes #1879) + fallback to lseek()/read() if mmap() fails (#fixes 2666) + [mod_auth] skip blank lines and comment lines (fixes #2327) + [core] fallback to write if sendfile not supported (fixes #471, #987) + minor: add missing #include + [core] preserve PATH_INFO case on case-insensitive fs (fixes #406) + [doc] add mimetype.use-xattr to create-mime.conf.pl + [doc] NEWS + [mod_ssi, mod_cml] set DOCUMENT_ROOT to basedir (fixes #2383) + [core] cmd line opt to shutdown after idle time limit (fixes #2696) + [network] separate addr trans from socket creation + [core] lighttpd -1 handles single request on stdin socket (fixes #1584) + lighttpd run modes for idle timeout, one-shot + [mod_fastcgi,mod_scgi] IPv6 support (fixes #2372) + [mod_status] add JSON output option (fixed #2432) + [mod_webdav] map COPY/MOVE Destination to aliases (fixes #1787) + [mod_webdav] improve PROPFIND,PROPPATCH (#1818, #1953) + [mod_webdav] improve PROPFIND,PROPPATCH; map COPY/MOVE Destination + [doc] NEWS + reset response headers, write_queue for error docs + fix typo in new cgi.x-sendfile directives + clean up oneshot_fd resource upon startup error + minor: fix compiler warning for extra ';' + build with libressl + [core] fix IPv6 address + port parsing (#2204) + static build instructions using SCons or make + [core] fix config merge of array lists + [core] simplify config merge of array lists + [core] add default modules while processing server config + [mod_auth] preserve WWW-Authenticate for error docs (fixes #2730) + check close() return code after writing to file + [doc] NEWS + adjustments for openssl 1.1.0 pre-release + [config] support include file glob (fixes #1221) + [mod_evasive] 302 redirect option if limit reached (fixes #2199) + [build] enhancements for cross-compiling (fixes #2276) + [mod_accesslog] report aborted con state with %X (fixes #1890) + [mod_ssi] fix SSI statement parser + [mod_ssi] include relative to alias,userdir (fixes #222) + [mod_ssi] add PCRE_* options to constrain regex + [mod_ssi] more flexible quoting (fixes #1768) + [core] wrap IPv6 literal in "[]" in redirect URL + [mod_ssi] fix parse of tag across buf boundary (fixes #2732) + [mod_cgi,mod_scgi] X-Sendfile sets file_started (fixes #2733) + [mod_fastcgi] no chunked response w/ X-Sendfile (fixes #2733) + [config] opts for http header parsing strictness (fixes #551, fixes #1086, fixes #1184, fixes #2143, #2258, #2281, fixes #946, fixes #1330, fixes #602, #1016) + [config] normalize IP strings in lighttpd.conf + [build_cmake] use MODULE on Mac OS X (fixes #1761) + minor: quiet some compiler warnings + use buffer_string_set_length() to truncate strings + use buffer_string_set_length() to truncate strings + [config] server.bsd-accept-filter option + [mod_webdav] create file w/ LOCK request if ENOENT + [doc] NEWS + [mod_webdav] getetag and lockdiscovery live props + [mod_webdav] create file w/ LOCK request if ENOENT + [core] buffer large responses to tempfiles (fixes #758, fixes #760, fixes #933, fixes #1387, #1283, fixes #2083) + [core] stream response to client (#949) + [TLS] release openssl buffers as used (fixes #1265, fixes #1283, #881) + [config] config options to stream request/response (#949, #376) + [core] option to stream request body to backend (fixes #376) + separate routines for reading output from backends + [core] option to stream response body to client (fixes #949, #760, #1283, #1387) + drain backend socket/pipe bufs upon FDEVENT_HUP + http_response_backend_error() + remove excess calls to joblist_append() + defer choosing "Transfer-Encoding: chunked" + asynchronous, bidirectional streaming options + fix errors detected by Coverity Scan + [build] update Makefile.am EXTRA_DIST w/ new files + chunkqueue_append_chunkqueue() + fix errors detected by Coverity Scan + [cygwin] fix mod_proxy and mod_fastcgi ioctl use + use con->conf.server_tag in modules + [mod_webdav] remove excess SQL param to UNLOCK + [doc] NEWS + graceful shutdown without unnecessary 1 sec delay + fix error handling for portability (NetBSD) + [core] disable Nagle algorithm (TCP_NODELAY) + [core] add declarations to fdevent.h (#2373) + [build] add $(ATTR_LIB) to liblightcomp_la_LIBADD + [cygwin] minor: fix compiler warning + [tests] remove dependency on CGI.pm + [core] fix s6_addr type-punned compiler warning + [TLS] fix return value checks during cert init + [core] fix server.max-request-size to be precise (fixes #2131) + [mod_webdav] fix proppatch mem leak, other fixes (#fixes 1334, #fixes 2000) + [autobuild] CMake check for struct tm tm_gmtoff (fixes #2014) + [core] remove assert in fdevent_unregister() + [mod_uploadprogress] fix mem leak (#1858) + [core] make server.max-request-size scopeable (fixes #1901) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + fix gcc 6.1.1 compiler warn misleading-indentation + [mod_accesslog] %a %A %C %D %k %{}t %{}T (fixes #1145, fixes #1415, fixes #2081) + [mod_access] new directive url.access-allow (fixes #1421) + [core] fdevent_libev: update use of ev_timer + [core] fdevent_libev: workaround compiler warning + [tests] remove some tests duplicated in mod-cgi.t + [mod_cgi] handle local redirect response (fixes #2108) + update lighttpd -h + [doc] add self to AUTHORS (discussed w/ stbuehler) + [doc] NEWS- update to 1.4.39 + -next is 1.4.38 + fix packdist.sh output links + [stat-cache] fix handling of collisions, might have returned wrong data (fixes #2669) + [core] allocate at least 4k buffer for incoming data + [core] fix search for header end if split across chunks (fixes #2670) + [core] check configparserAlloc() result with force_assert + [mod_auth] implement and use safe_memclear, using memset_s or explicit_bzero if available + [core] don't buffer request bodies smaller than 64k on disk + add force_assert for many allocations and function results + [mod_secdownload] use a hopefully constant time comparison to check hash (fixes #2679) + [config] check config option scope; warn if server option is given in conditional + [core] revert increase of temp file size back to 1MB, provide a configure option "server.upload-temp-file-size" instead (fixes #2680) + [core] add '~' to safe characters in ENCODING_REL_URI/ENCODING_REL_URI_PART encoding + [core] encode path with ENCODING_REL_URI in redirect to directory (fixes #2661, thx gstrauss) + [core] refactor base64 functions into separate file + [mod_secdownload] add required algorithm option; old behaviour available as "md5", new options "hmac-sha1" and "hmac-sha256" + [autobuild] fix missing header in tar ball + mod-auth.t: no crypt md5 for darwin + [tests] test apr-md5 in mod-auth.t + [tests] do not half-close socket before having received the response (fixes #2688) + [mod_fastcgi/mod_scgi] zero sockaddr structs before use (fixes #2691) + [network] add darwin-sendfile backend (fixes #2687) + [core] show correct crypt support result (fixes #2690) + - next ist 1.4.39 + [core] fix memset_s call (fixes #2698) + [chunk] fix use after free / double free (fixes #2700) + [scons] fix fullstatic build- Add perl(CGI) BuildRequires in order to be able to pass the test suite.- update to 1.4.37 + - next is 1.4.37 + [mod_proxy] remove debug log line from error log (fixes #2659) + [mod_dirlisting] fix dir-listing.set-footer not showing + fix out-of-filedescriptors when uploading "large" files (fixes #2660, thx rmilecki) + increase upload temporary chunk file size from 1MB to 16MB + fix undefined integer shift + rewrite network (write) backends + [cmake] lowercase commands, whitespace cleanup, remove clutter in else(...), endif(...), endforeach(...) + [cmake] cleanup cache variables if features get deactivated + fix some unchecked return value warnings + maintain cq->bytes_in in chunk API; keep bytes_out/bytes_in synced + [cmake] don't put date into config.h (not used anyway), only unset local vars for disabled features instead of clearing cache + [cmake] fix FreeBSD linker bug + [tests] search for perl in PATH instead of /usr/bin; whitespace + test config cleanups + [kqueue] fix kevent call + [tests] fix warning about newline in filename + [autoconf] define HAVE_CRYPT when crypt() is present + [bsd xattr] fix compile break with BSD extended attributes in stat_cache + [mod_dirlisting] remove sys/syslimits.h; base.h already includes limits.h + small README for FreeBSD build setup + [build] put --as-needed into linker flags instead of cflags + [mod_cgi] rewrite mmap and generic (post body) send error handling + [mmap] fix mmap alignment + [plugins] when modules are linked statically still only load the modules given in the config + [scons] various improvements + [mmap] handle SIGBUS in network; those get triggered if the file gets smaller during reading + [scons] fix crypt() detection, other improvements + [scons] fix build + fix some warnings found by coverity ("leak" in setup phase, not catching too long unix socket paths in mod_proxy) + packdist.sh: use fakeroot for make dist to have root owned files in tar- do not use the full url as we are reusing the debian tarball.- update to 1.4.36 + [configfile] fix reading uninitialized variable (found by Willian B.) + [dist] add dist-xz, remove dist-bzip2, allow ~rc appendix in packdist.sh- update to 1.4.36~rc1 + - next is 1.4.36 + use keep-alive timeout while waiting for HTTP headers; use always the read timeout while waiting for the HTTP body + fix bad shift in conditional netmask ".../0" handling + add more mime types and a script to generate mime.conf (fxies #2579) + fix typo in NEWS entry for #2579 + add support for (Free)BSD extended attributes + [build] use fortify flags with "extra-warnings" + [mod_dirlisting,mod_redirect,mod_rewrite] abort config parsing if pcre-compile fails or isn't available + [ssl] disable SSL3.0 by default + Fixed typo found by openSUSE user (boo# 907709) + add NEWS entry for previous commit + [network] fix compile break in calculation of sockaddr_un size if SUN_LEN is not defined (fixes #2609) + [connections] fix bug in connection state handling + print backtrace in assert logging with libunwind + fix buffer, chunk and http_chunk API + Remove chunkqueue_get_{append,prepend}* API + Remove buffer_prepare_copy() and buffer_prepare_append() + [tests] improve valgrind and strace TRACEME, disable condition logging in normal configs + Use buffer API to read and modify "used" member + rename buffer_append_long_hex to buffer_append_uint_hex + [buffer] constify some parameters + [bitset] unused -> remove + remove unused stuff from server.h + [crc32] fix method signature (const pointer) + [tests] fix undefined index warning in sendfile.php + [mod_auth] use crypt_r instead of crypt if available + fix error message for T_CONFIG_ARRAY config values if an entry value is not a string + fix segfaults in many plugins if they failed configuration + escape all strings for logging (fixes #2646 log file injection, reported by Jaanus Kääp) + add some until now missing files to dist tarball + minor spelling fixes + fix hex escape in accesslog (fixes #2559) + show extforward re-run warning only with debug.log-request-handling (fixes #2561) + parse If-None-Match for ETag validation (fixes #2578) + check pointer before usage in new etag compare + fix memory leak in mod_status when no counters are set (found by coverity) + #ifdef all parts belonging to the connection-state debugging + [mod_magnet] fix segfault when accessing not existing lighty.req_env[] entry (found by coverity) + fix segfault when temp file for upload couldn't be created (found by coverity) + check fcgi_env_add return value (found by coverity) + mime.conf: add some new mime types, remove .dat, .sha1, .md5, update .vcf + [mod_proxy] add unix domain socket support (fixes #2653)- define and use pkg_name, pkg_version, tarball_version - use debian orig tarball - fix download url- Deb .orig.tar.bz2 -> regular tar, hopefully it shall work.- Spec-cleanify and remove sle9 support fun - Fix rpmlint warnings - Use tarball fetchable from upstream - Remove all obsolete conditions- Remove the debian changelog also from the .spec file SOURCES- Remove debian changelog as it collides with factory checkers- fix bashisms in pre script/bin/sh/bin/sh/bin/sh/bin/shobs-arm-9 1585219700  !"#$%&'()*+,-./0123456789:;<=>?@ACDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk1.4.55-lp151.3.6.11.4.55-lp151.3.6.11.4.55-lp151.3.6.1 lighttpdconf.daccess_log.confauth.confcgi.confcompress.confdebug.confdirlisting.confevhost.confexpire.conffastcgi.confmime.confmod.templateproxy.confscgi.confsecdownload.confsimple_vhost.confssi.confstatus.confuserdir.conflighttpd.confmodules.confvhosts.dvhosts.templatelighttpdlighttpdlighttpd-ssllighttpd.servicelighttpdmod_access.somod_accesslog.somod_alias.somod_auth.somod_authn_file.somod_cgi.somod_compress.somod_deflate.somod_dirlisting.somod_evasive.somod_evhost.somod_expire.somod_extforward.somod_fastcgi.somod_flv_streaming.somod_indexfile.somod_openssl.somod_proxy.somod_redirect.somod_rewrite.somod_scgi.somod_secdownload.somod_setenv.somod_simple_vhost.somod_sockproxy.somod_ssi.somod_staticfile.somod_status.somod_uploadprogress.somod_userdir.somod_usertrack.somod_vhostdb.somod_wstunnel.solighttpdlighttpd-angelrclighttpdlighttpdAUTHORSNEWSREADMEaccess.txtaccesslog.txtalias.txtauthentication.txtcgi.txtcompress.txtconfiguration.txtexpire.txtfastcgi-state.txtfastcgi.txtfeatures.txtperformance.txtplugins.txtproxy.txtredirect.txtrewrite.txtscgi.txtsecdownload.txtsecurity.txtsetenv.txtsimple-vhost.txtskeleton.txtspawn-php.shssi.txtssl.txtstate.txtstatus.txttraffic-shaping.txtuserdir.txtsysconfig.lighttpdlighttpd-angel.8.gzlighttpd.8.gzlighttpdcompresslighttpdsocketslighttpd/etc//etc/lighttpd//etc/lighttpd/conf.d//etc/lighttpd/vhosts.d//etc/logrotate.d//etc/sysconfig/SuSEfirewall2.d/services//usr/lib/systemd/system//usr/lib64//usr/lib64/lighttpd//usr/sbin//usr/share/doc/packages//usr/share/doc/packages/lighttpd//usr/share/fillup-templates//usr/share/man/man8//var/cache//var/cache/lighttpd//var/lib//var/lib/lighttpd//var/log/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Maintenance:12187/openSUSE_Leap_15.1_Update_ports/eaa90769400a9aeb91e18cd49f842a90-lighttpd.openSUSE_Leap_15.1_Updatedrpmxz5aarch64-suse-linux  !"#$%&''()*++directoryASCII textC source, ASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a09a20f5ab5782f1815f9af1893d0401477843b3, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0c1524d27dc623aae1567b6125777c2acc13d0a0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=511626438a101c1dda33dce4da26b224920ea03d, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=31fef28eecd1ac900840ae406142b77da174c71f, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=406303837e2a3c5c20f1f93bc453d345b779f946, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6a007a1d1933a545b39b9fe3a8d30e1978e233e7, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=43378a438bf24e929927114d54e071e03aea1848, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f1723cf881d9cc386813304c75c4eced24bf6edf, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=094ab4d2529beb9a03158695e268734cf184f359, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d03316033dafd9f118f4cd86e4369c3dec1a8c00, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ef1be402518e50bd15cf8e71467f7c7323cc644c, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a53a07f782789a993a19ea4e8ca3f391a29a3e51, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c9b764dc063ee4388882da539b45478993417657, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=efa66195f7b517800bebfd21a76b3857456f19ec, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4f2997ef75380c3e4eae5d158923f2ac7b636039, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6a19a2989c3e5a17686745bf4b7ec4772c4173d0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c3ddc33e233550165e368c11cdcbc802cacc8d77, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=912480c58f51d196174b29c61f8f7ef1373e000d, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ca200c3dc4f70c171373acc11c0e56183d2f9ea6, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=21d84081bc95034a7a26bc864a42f8c6371cad34, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f097be5a302928e3a88675ff916aac60b1f0eac5, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=852617f4b0d8eac462ef8d5730e52839f5349cc8, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6f7ff68213bb9035d9b30426e46e5eff06af76f6, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=55a8d02fcbad9964036fc63d29e4d9c7cf567a70, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1759fcc0e935f53a9f76836735d29687d53fc8b2, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9d89da63d89aef288bfafb0c3439ebdb6bb4f7b3, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c10fe5987c422ab0b53580d636627fb67c6c12f7, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9c2505af029f3729b4446e71061a2677a12a11f3, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=40cbd3b7d7253c19468410e7ca03933e10af49d9, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=09f51ba4fa224d14b863e1d2117fe4a31cbe245b, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=97b699448b788032305b976a4c0eb6c3a8566cb0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f24e3119d362df97cbdb0344e00baebce757310d, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=104e591720e4c91e7e9b07fc0e5ecb2bff9097f7, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-, BuildID[sha1]=1890f0a0777129d1fbc56a7ebc1f11f2c4f56adf, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-, BuildID[sha1]=4cfb178f4ad0564eb6ca156f10005e3915d2e08c, for GNU/Linux 3.7.0, strippedUTF-8 Unicode textHTML document, ASCII textBourne-Again shell script, ASCII text executableexported SGML document, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix) "')+-1579AEGIKQSUW[]aceikqRRRRRRRRR RRR RR RRRRRR RRR RRR RR R RRR RR R RRRR RRRRRRR RRR R RRR RRRRR RRRRRRR R RRR RRRRRRRRR RRR RRRRRRR RRR RRR RRR RRRRR RRR RRRRR RRR R R RRRRRRR RRRRR RRV!ȢogQ!)lighttpd-mod_openssllogrotate1.4.55utf-8098bfafe0f2edda97795ce2b85cd384654d4ab05b70a8487fa05a9fa8a2a8518?p7zXZ !t/4]"k%{U}g桙Ⲹ9,Y,ځ_q!vkp"F2I)]hj)~ڦc!ո4҃RT]H14H2bwfTS}x?+-Sphv)p޴I%%4J&A<p_ FDEG^yn)~o \!y0Ybcq}- ֵX2KM ˫笭h$C ;V}nGHї'B¨$f,-C4LQ)]i}[d{7kJ>I "* }j?TͣP :V+534Nԋ3. *t7wvCq).I譞a=ROwdO|I>!xA0fN&`wjyO``o7}dB9W:b!߸ް]}w$ t.-+E9Ǒ{6~5QO" SZ̴Hr\(o%WDBxNkuU^ɛ . n͘oMhdƍz`Y]O ZlD`N˾SDL޿N?ruNbY(.f36M0 چ͡JJ@q+4`?$*\ӿ+$8]ȫ%Kxgrpʠ<|dIrG_Nݚw3q +SX־As al8Yg"vswjIBX9*1DŽZ1$cQ%0ok1tYSQTݪAY RX*?gnxVõ$gvBys/&,d;[\P7E'_s[)8f(:-T zEb|jY8y$㿱.!dvxlc&;7N/0B  = ؎(I<(A :AFƒ(>չYqud.KnWsce^C,:_y+'GLMH6=DZӴEˮsRV+>\Dn%w;ށ 47I\9M+~N]y>uW=_E 8i#C?q cF<į 7N׈}`c&C/qut,ܶzKiw4Y-? t,uS[ Q@#`W;QhJ͙9&h%'͏|z9)a݅TQæ9 ܑ$!C2cxiOL6q~Nld$QC}1rV8W@V`6sL̹Rmc0j9Q7DGrv9d>nt0bI\uA1:/ϊxJ`2wxV%,޸+^ gb)'dYw%T0ɚi"Ju-W2dΡUe 31".-V&=8v(Ri[j,3t]!7Xd}3xjC9 h`Hi̤R0 ]_ ^ؤ}mY<r01*oZ7X;J"!d"TVSKSLidY*qySS_ 8`dt.,ʖ@t {1zu%; b Q8TbЃρa Lҍ6re31kw# (ut^ )R[kݚփ.D`&:34C5&8ִ1*=BĎ˻+{@<Ť\j?<.hDk "&m{I;1׿02 F0kvn`v"WgaE3$7IތF ( ;Z5lQߺQie'Dbq_#" RXeu~ jl$㎕>w.YDo˽nJڢqU eJiu%/y9d${ ,oH#ak& RG?T$CF_5%8VvqÅx׈՚$#ivJq7 h\!35ςiGEX&ļL531Xr Ig42AƋ>C'f2y=l6 @qC)6Ykp'Aq=&/5̊D*NDv ߮4̘f_лMyJPlߎXG$~64(:]gze=ϐ!}|?wLyQj&i)%20 X!,7(0,c0%ϛ,:9BSTq#(8XswaH;Pma ݂ (`x㧯XLYEx#+͞&v,VwX)ˈ^Q("!ą 8d iM -/̿rwM@-/?IݹaO*\!Jq9sa4M<%5,"mXs\ʝǹO_Efa+?JYJ[\"gs}W? БZFŦ}&fLꨆۅ5[8s踄wü+8*3Gկy)zdlL6L)1ߑ SnYJc+60:7hJMQ1##둨8:rv! $IRĴy t2d Vx(!@?%։n^/7&LrSOEA,Ĉo$s%;~'&4( kR@*q. ʁ zL~GM@JќK7C-rmmQ3?XƶJ{):TIaq6L HTpFyN?W@-SbO@E"͛x L17v^S5c);EWl"&#Ҕ&In ~zVI:^,F2M"Q 2f?#zPPSLH4Om H_n}q5nZlυ`NaLZgǽlZZ /]#h=3yx5o;`Ia&eH;#/JhPrܩ~KqCxuFWCl =<SMWJ-wVg{.h>jN>AC?NPVW)h` 3}9MFfƪmJZٛOT#dg~u4YjzDFVsqeZfLI(e\fJ@!V\:OE0Քc]ڥ+^u\RP四-sI>FAV =Aĩ;~H2W uS%F٣]8F'%b#&/yQ1GR2OUp?4!"{la>F05vXA͉ =/7Jc9axnoV |_W-4ԉ_UFr虓.5g!!~LD8:뾏ol*,[EEUͰʉ yG?%[AM8lA/)+5EH%.PT@Yɡrw̧%TP.nm%~'36ulp4nrL]k: Ep(um?io/ab!We_Q4UwuCJ=KG x]qNT/Jt 3fښ~~ C9KA0 ꢨ^ƁF/RW24X=UM ;yPūv [}a8˓Ë]ŋ4Џ;;sx$rG &ʾW2iCl˥^ޣ/˲[^^tw0++ȥH]%n/84'ֆ{/8h"fsYH_&Uay҉SIk0򡳕$oj>ďQ%4GH'&/}GWh$軜N@S}I` H`gcr}Sy5s1mXa(`;5nYFhgʎ3H6P N ME$hKEQTyueEրfs0HaME7qs\-f=\8@nIƛoJAQY>TH㣬I*  tJjsVR-o ZX'C5ᒒ(f"BU;r\SN$s+ 'qz8#{^BRQ "(NWF> uhOU2ҎpE"JzU3(@7b́`AjGHZA2!G2=Ebƈ[30c~8nm)/RlގٰY-¨H,`GVvf@\nˉXB\!qӬscZn< S֕W~2/tH%'jn0^6> 3!`r[Vmp7Fgo. bW[CQ)_/ `E]`9~+)e]yO UJYS|")mSV='ʙſ VH-,荷_qSN 1_qJ*켝䦻<ljr<'v$rU%E1xA@Dl˧_-Ө2v79$hSʭ P6fGpKEOmwٿEWh!HZ[T :0M/8PFlïmm7_swZ0e Pr@5$#_ +jS02vك@:,~gѵNxdx$,$?jo'r1/ _|)e~ 8`=P6.C ژˌ[#ON8'ҩ D T3^\!RV]ոR/^;'K4n)p{Eº|HBV(Bw~WrbW~(JԂu6hj-|ɩɴ-0}dv2Hÿ-Ӹz40rfaL륱֮\x ۔H3& WLa.dh)\"X!䧕LWNtս]/𺚁*T< [p5Q{ӆgh_`:!mzJBm증겖d6 z ވdm%j|;}A;5.AjwW)z ؎I<^9FFPp$caQwbR\{J#pyN >y6'%l¶p`κFG1'KbN{sH6l .s(}*/ܶDhsŦ׀FTKd 4Yn{/$']8lG*baAb)(΢b 5/ۨ BHK j1_ܽ)bVo<K$Xv] mu2ZR b_=s0[^7tB#%f_(vi7Ojý Ŋ[ȹ@LF(ßR޶0r\M'%$ԍbyEnrPPR)dOWlQ -:T4xYx:*[sWL`4j%f7]>^5qO ]p(Xwea!^ǺyA"$|#ZjHosԷ6Z$v[ښ7sЬBBDDSΕ `vcQ&iXSѦQ5`;S-WELʙKvpŸgT~ i-orwLy R$/PǵΗ#{ _TUţx֫"  dq6@l}l֋2xzǮoCN%s+S#Ro=`!vl#X׍]R_;TI$ٰh{o6 I,3c/-3pw"#Η[5G :d̽)+QfUԯnMh|/Lx!ڪhGc7aHI~6HIp8v۵7R, ܪF.HAD-zQHھ 'ٝEp̆$/\5RzWrΥR")ut.{~PXOe:{c gѲ^NWvǢrfM񕓆-ctcVdҸkR[@~ݑ︩ZS;I!*wdR#)DplMe,[y[pjr†&P$vmx>PUg] k%J|I4ԴQkb`*w6Y^r:{ry-Yx 1(z%"hY5X~9b}(m*z!xjYσm5k:qRLOռ49!;YveD$9YNzЅ*cyhݠkV/P]2:p}vQZGbVh;IFEd=+,<BoX>!n.090;h$l2%^ * EFW F݁Wyx`}R JE?ӎqP>f͵]eci݆8\8n~n}3e JTCjסSfgڤQ2HC+ t\Lrza\m9$+օ47+˟psXw>S?v%Q_dO' ܵ\uۅKBg'@-z4ی&\M]:?ڄn ﶹtߜZB,sv+̍< zEהW>/ĺTyT d9gTvT9>F,e\n^c35V0{ZbvԥbK }}uΙJ:Jܡ&N-P"<Bݗs Eb> -1ִD8AXjft߈"*`Ae<=p2CMZ-t:8y"ƨJ]A ^~caC bdJ0iK*~Wϯ264]7Lzd>@J8aﳞpmL{E;Vcf߄f5*r`%-Xalw̩B! F;=\)ԓ]5I`P[Lck  s}|FZ +7J XR}ym'`AR=Z5QG0ᗩ~6>a*qI{n垻&M ;4tI ȊX|TGs4xDmⷚ-x?D;bԤףSfsa*E ܜ- @o4-4R.͞ٽ_0O䗄05[%;.N_%v7mZipn)c P ӯ^1B]8RSQX {A]Q*m2͖4VGڻ!v Wc>+ 'kMo lUzP d uN$:f(7 xEh4mCar(16+xB2 G2Vy4ۋ+kʢT9EG"\`n/󍙋X|$שּׂlwK"p2 O,,tv,xfCwpf b &"!¼xI:+!Y³;*-Sc_^Ϛu]?-Nj REC[rvN^A9R -NV"2̇ZrF78dEМSiX%YqI)~%xP"9_*Gl ʗ"T/|uBݼ'8X2y8~yGᰵ{܎9%mvH~` sGX.`/s[ Mxk[i1ҌcS' z >ٔʳw̴Tє .r"b9/e68mh ]|Β'V|-L#7D |? vWvQg͇ʪ7Pid?Bij|k<+dωr9!Q}4Ḻ;n"sY 3C @)5+#yF#,Ӯ9 B94՛*"oqw?Ō}0SH ^N2Hoᒈ~Gn6K~_ӾB`DZ0Y l1?w<]?U"羗:L a>y\o8`=dAf:Y %tU1-T8tDyVp#r}:͇'RAڃB:"v A^]yEh|ʡ@ѿ6<5 ^pjxAxPmE=4oۊ=Qԋ4g3M/-"C80ŝ׈YVn5 ٬.7:0#M䪕􁇾zy.03B)^_jَ*!Xr7 Ձ\R0BYsS;k ]:/^@z@eIԸc$y洡輨UaIrK<`|:b&*>ka5d@@{jS:(U|t l꯭N oƁT˴68LlDqa/nFcb:')7zV[-ׯnUeЉ Z|YNe5 b>3'θ;fe񍷮A'Dkl~@rm7KClԂGQo"D2g?|mb,ܖ>|x-AX,6\V$[ۋ367uf*Q 6d*6VTNUok8/.6̂XEmDk##"xhC|M(¸N!8D;3O^b|OmDOc2X)79ƂtF+ΪŚI! ;|\]@(iPCwaJ"B<,b ?&*jZ֝-R=]ϠjbeH`+/t5OUt4wȊzčʴ7Q` Y*Q2b2sm mV D֞'wHN&^'OS?,փi4W Au>Uj#yҦǼG@W'ibo2נJt9AuZ="Tu<:Iáy| R -Ǚ{'P6)/S^I K.Ρu!lqG`TP 흛^e!yi̯Z`? 9Tsks`s׉JF(8lC!%鑸چWN%5aAQ$qM{2|t v*o_]ڭA"HvV%K/8 |(^L/%M_yވ[+N%~Q5L2&ue,⪏CZIӍzA?3_S+$8*X'w#Ԯd4;} vVpL\e|P۶@SBQor|k$1 `$vܮ1oI~ڹ>=GYtV]LMd"Cs$mTQ9Dql)VVB,rĊSQ8۱ͼ\Ǔ_PJśM({UwresǂP" [dq[n0nUu1q.qJ6V$ gʼnB5R8-&B4v9+5S_"WΈ U@B#8doxTR&qE#_PÈ%gr)t邧MwP >q/Y.cՍvg/P뷸):.O p%wwV:1~3EmDžRmܑ>$i60$Nv -Փr}xizE"ՋQڤ-jEtvt|g+ UAEaIR v|B쐬H⯖ Q REtR?AqExҥEbxs+_:rQKW7l[D6-F-E/"?aI,S־fnv]+$q՚ŨUA#st6E_+Mn^3'*c F+('u^NZ}lmfpa/ W"Z1LoÝ/>Ѥ}jm~6[Nֱ0~C2疑v qZdw-"K&NDM.MƧFB6K\n-l;+2JVp@h:=dϴG?/H,Yw3esjo`\|z)&a9> (DMyMXj~TMa<?C0(PDÄndu7]*cOi^1~3V@RLD*p( .J yߍ*4<ҷH0j8]C0N #הh({5Ը+j{BB]\STaF=}&qxj7hb>%w#PU` jELuY v݉y 霶k XԾtvXtUJՒ%%_ujeݻ3 xC8S Vb0&]7*'Sώޢ4 t';1I5ְ̀q#<dY @r.}lU .sYq{JLgA#_ P<SxЭl|ɑ {&uY+zޙ/)AafU ԑM]< U-z"[T8w+9q )[XdXڝaHd/cZ 1'.o2^ Ҳ~j%<$P0!?b2rdv3@:%fȬg6뗁".h6*}j ٚWZmm.tDZ\o H~;/'-sĀPޭ_tIޠИgy.oh4-+K,Τei%x 冇RJPmXԳ̶L^UF+Й + c'jrOOB6nsu[†!qq9mG F,bav XCT gKYV߭rܷ1J%X:nJٍlҡ]xNՕÛE(Ѐca)# /Ҧz“u*/dD%#i#"s@e t܃Ǫ< 30ߺi9g_.9lvsUSb~.Pi#eul#٦a wr,*Ç-~VzJZ:p+ЊhjEtE~f L+ lO "™V(e^b;AҮ/l"}=` <52u=M tu6pem֌Y7.6Vu{|ZW9H'쇋uX+N-࿹mxXSփ MpG%|.`@!"~.7& tWuوmy{?-wy/Ăkd`R7t Y^.id}ҕuI0b51EuB21B,oMlPГ" Rk*"%讌Î{oEzc>Nddh(auZw[MIGŬJ*p~CVӄܕpԅ7,/$SU|g9{>|%@Cy5mvi%1U_-XѦR`r4pFR?dnv0D ɥ'F:c{1]X4mW[(jDa|mF 9(xbi:F{3kn.maE6>B<GpԸ 2N@iJRvzW,kmF@=Rdgz MC$%4=OZcEam(RcoJ}/b>,p<~)r} Q(6$Z8S4bӾC7P0I,B1Ӽ_zQ/Rds%;7%n*l^Ci9U ϧ/9^ѱ%+w=gD6W5ljɘrOE4&@@n nX'E^GpuB4녍$;+i1G8G1eUU@O7:t50r*.$VHؤ\?Gw-*pe4h' SfZk}3#ȓJTL\`- 6MuxN*(<*@v IH,}u{},@ac|PJ4J 1Vu86e0|'=SjVVd,G\XL'JYCH^',>Cqݑ;8|z b&gπd@(nx?`jy;n Mʤ;e /E4p59>~$8,8}wM?Do%Jd<{/OLqup}szCn%WN8yqώ;H&H\N}_[c@,س8öɘV}tG4 pos/uZ^/fmU :oHCw+Ԯ6R>_ɴ̢ZDI2~B<4!zEUMNo8בY%pʀj b*`l")!kοa C󯀧(2l؋I-F4\AXt6p+^A#2Um> .{vP9{5;LZ=3Q>5l??-a-~jD!U)@5{OԮ$jwE|Z2,-%'9@ %K<(?={ O.z^퍭WC4^A݁.䩠\hvjegO5-%nJ^l\CbpSwuJ"sS&W #o @징lo2Dڴ&-XH !Aav Ԫ{eDq}3&>)W5Og9uv$vz8RV$f=^| 6'w;{a!wB*O}O߅Jݚy2 FpVFk^qp*^k/,^,91! 2Yr~0,#!5*ӚQ ?hsYDs`bK-:7XJY2-F1|a)O*^Iۺ0$Egb- ꒡t\HkVѶ+jnɗl,]n6YڼH+16'hXBw*>q?usݺK'˽@\^q8O0o Mi7Oa.C񛱫L夅Yn@%K$wԔZA?. Jy7OUʼ)ϖ!hdL)xmX J.sjF|^{e=1<~bR,`̬'p._HВp !\)jIw%ToU^\һQbw+fW#7W?SqsY﷥%!&CT3$ /\л^l+ 56hOANGzu%y[H{b8Gyua;:ѕq1כ1E;WmdU2wXV@<rw,waErpn߸z$Й.Sw_ݫ9pU=Ds,'XV {D48XtuowH UmZoky g/µ+=nz~e7I>Y77@ZWbB {]p҅{QK^> {p8CuN+>]Q\6)erZpKЍ8jM`)yxzUIzCQ# dIl - |㼠B h3\ohw"2bJƃj]Jgh++V1q6,Fo)5R4n;3D~t's]6Ѐ) nS֨?,g+b^! [W1N/* IÑHaۼPXi僾P]qGέj rQՊsz酼#,,yn5Ro>]ZYwfi)$~R-t .oK?fmQ8'cm'nfzj=*TNfnLvV boU I_Gz ꂿ3i^UkZ`ܛueQO1^}+d5`sb7oϩhH ծ-+,>t܉翞PS;"r꽝 ;_QcR]4D_' ݓ/sPQt636fb3EQoϧG`χ_Sogύ|ɖ]{LmvF[OX!D"D"9r6WVJ6ybn7,h79ş p\Zѓ udހç[#LW+~?cڒ݌?o Wbfq2 "{_0^,PKrЛ#ڃ?u_|/X G- Ԝ<)~u]VpQV0kh9:R3_fB-1R`Xç-"?]qω=W(H6n@'eEs9R*/pPl9E2d>ZOdfZށI g\JꔊN6 $!ϑOs SݽK)mA^'% a&*kq4wQDgCBvv>e)#n*bp Y[FiM >:<5S$>|X3~-L[hz:ڈ>P7RZʼoJ” p% [栵~g<Yr4F@4Ze~ +* h~fv~tbIkH8gɚ"}*gf._ϳL/<*dL2CƙZXR^KTw ؈N|h+g#:u9F7EޮwD7CbIu _!sCKW̡- qU݂Fnl4ފ%b"҅g> TM}6h4/M&{zX0)J既VxjH<g-{8s잧uS@z}ҽ)S0<$i)P,yXI;^~w>77G4K5SNs LG wDWv[UhmD0Z?8G\Kqz96l(\0'JKACvid}^@# $#[7cn_; ҁC%='tNݧagㅽа=ǰ巼eZskv,H?WO! <'8L1zR-+^-/G Ǘ {^&;in9IWk+',XF"=MxoWh*; NKd2dl6=i 4ǪqZH2 h}OV-Uc-4flsE{?ލ՘ !{OHWtiC$ L lWI_='~ ꨋf| = piNtóf-~y qF'7 8?Nu1vme4czTIUQ?My֠YȜ{J2=ܞs{_y0'xU׭Pٷ,xSbI tT Pmmoi9KM ;fRO#Bcf fe+GM!H W9i`X+g=:B2ixiOyhC"5M#ѯ7~!= Y("oՖgoUj \n1$X ah/6y'!crZ*-C/+ˆ|cCU81#uM3!5}@B>:F3(L436!\?}ӴHEZQ[)bA۟$HE\kYlO`FB|/W'> B] kD5:MGcq\`ENwb!B-<c5y/)cI]PijQjJj /j$~!}sΰ8vhWLj~GXk/qlq8wZ@;(8xV c}GXOGD_HsXqy(Q߼E ~AS:Y"ݘVEq?e0gU(l, A p,ŸN 1J} kQ*D& mDG[HV &PZ1Sj:Ę*lpN_=@AhI zG, [gUΟuZql д'3ÆqtgDVjmpXvdNJFקݪT,Siݖ@Z9GBuDxJ I;X6KA+BQb(f#v0!OPg`2^BC71UP9`"DyO{"O#˧KעJh7;9jzY@#jnGYvhpxoM b21;,B-bCnU"0~B~d*fI$wG>E7]B R' 7 $ъ|e٢`?pиF1QRh=siF.%$m`8p~vj"֗Pnj?ǫO_;9 `o'Q hi{#xHv輆§T;*` UڷwFy+%5o)ChW%`@bNJ:_x\78&iڑ@ sۚ8#~my`y$gk/V ܁k!v65l\Ӽ3v0GDE~o`_}KT®b9eRzcdȧ{/ QJ>AGnSHJc]^C91ٶ{azuٵĈRH׾3`IJOO'$]'AN>zBuJ\ N]:|V+wFScԬJ ӻcl82|_} M3"'eTw)M5ua@e`nXnLm:yaփWN;l%\A$0\^XKԴB}(>4m#C뼱*9ܱ FM#u::NZ(#tv$}sX9Ej:/HMoJY^>| Ž&qe hvlaYtCZ?=4&t&]o<]|TO(nYym?ɺߪnv@WlוCHj۪cwdEF޼2{!ƪg{7`'n(Vbݶ9.$=un0Irt&qMA,k5FSՍlyУR%KC>4D1S7O4YQT%Z }17})Q#6s_A(.&!l,pڧBqRXV0D)J|O1=zF@g͡8{ ӝ& <W&AĪ[/¦y[*_]Wؼ}gZfcŔSFthO v*>Svxc5Nx<cBof, ]EZJHb3ίY%|z< S` cb G:"\"ʨlR+@E_B~;„_hY-nu nOⳀ[%_6$T O~+$g6hW'se̱L9lp~ E7αQgϒת5୧QkM+GUkl0>&Gm|ČJܒ;&ڒEZ  oQLN 5b~CH:1R g; fxQή=3>-O":ڊW^@PTwpNXV2da!S4{\w=QC Gq߯"!_?dŹCKm#ÿblMJye(孿{Eʿ;&s .ȆWLy:aeihp[(kإo,%7g8B 'P<(ko, 󲓂;JP1Z9SY"U>b%MX@*"or,ᑬa{hI:ڮ:~j3ia|JYfH^c8>B"dg{E bvo> wVϜ0v+qupo='Tń#^&8^0 r2'jgK0gS?Gb@Iri C;N(2Hke/vTE%/4KR_\2T!Fb>]6p ~WdbM6Wykm w4YcY w7V[-k6kBɉQ!^c )nt$IjZGJ%J=P^2I56+ ˥ȋ tZ&bSfW`>s*ݲ^uܫm-_03XtlPi˻Z[w?|m4BdKqA?eF/Y2XmNdԿ]l9(mmmHs1!^LT7QХ*~4#VD K2tR̆[Yv01]Ytdyy+5=~z +ކF`mXlB{M E([?,GN֔\Q08qkp6C,f $Ug9J$L~d&iѿZ*6 h!`&\)YDXd摟R. !k8G7&6e0/~,l<4]2/!p# KK7QiA)GcV}ͯ7W#J$L|3A$_0]y]Y Ί> ^ 3`|n)=]=-t:}P;.Luv\ ?k3"fG=|rd j0zbO6p(W 'mQg&LHaiH*8YyREߤ6tzyY|F ݢgq dwh+;YSa}ILe4;TVˋcSLU2+:F"nn1NFo2bF *rFܲ#.Ҝ,7D9:S$9Ƈnw!! 8[Ha%7Bӕ ' : |Rl օoV,ysb/9Pާ-SR \oAw`FdP{ U5'n[ :(cI Iͼ.*!y9ybt9@S:*S>lf&L3vI~rGsS3nk/ZrR'4) 8cӸwcѴ;{~e'dh/%sC]h\#Mq%̐0.ņjff\Z{b68ٗN>T@[=HȬIH?ޱ>P^"*= ]7"eoά^@O5%gi23Wf20ql stTu% ȀC:Kq"7Ȅ[& &(r),F zYnBi ܐ{h% TK|d$XП&KJp>]mvcY< 35h@7Εv% 苑 Hw#=/-" GЄF՛́~;_x"9}muH0џvlKa|iҜVJ׭yW*"'&g% >»Qشr>ZI⩄.t5#Dv u i9uR6i|X%tIq# \#̜#!XZ،S6ֆL2fІ~Q[P 컥?y ,cĠ/w$NčVNx 0\z-ZE!ʄ22G4(DtίEb̈Lcc~2VO"+~ꋌ.ةc9>{xMh\"'tdI5= .$YX;hLF3|4'%糣@yjerp\Y?ZZ慩R^[Rg $Mſ2K`ejd :aZd ODNd4[(1W 3*O$4U0J"3֝k|]O4D9Fɾˎڢ֙槌nYkP@*jŜX{UPD Z~G~~ Q9R>79a1؃X~6tTrr&\UCi3qY5; כju9K[{B d0ɺƞ-1_*Î)\sc9*HeyA$Z85NOmw%y/]EU #Wkt]:\{Eg7=c/]\?zFŅ<˛TwFp0KvqutĂ+'OJ@leuG-,~7,dzR52lߟ,8|TT^_BaEUfi`nsmɹ<υH_s oP,lwo+ͬ?Tm-0c+0^jd"\Zi?q.]\9݁b]޿ߔn ,P-l~M#d]0 #c׀26bxMXYW65g)ž3{|@ Zv4laKqN3g~;R|~e_0s #;}X wm 8y!JdNNvTscdo˹ԷQ؎Z;U_yoKucɆV2x;FJf-DY ˻Z6ɕ[N!L3ZD+ ۍL}jSB};9ʥUK>L4ˍ)xŴ dsX;J7hp4f'QLg,}e)o=JSxbH'\s)F-U?Cldt*o<}GQ T|Z4䩴FăA9#8?NpD_<R.u=2Ih+4 2RgILM I_DE}9tD?D} 53Mӽ!|E5s ̐}R9þͨ P<ʯ9 S2D {,_zinQʊXZ8/7Q#E> 9C iĻa©}0,HR#M*j*sxC&~VatQh]Lj kQU)0[:ϑ(Hw \~^5?@:Tv_8e4ކl8s^~-Yn+|.FLޝUE9f83gV­`,6Hs0 2J:sѪ0%͛uD;&]`΋1JsH仿>}g`,c^fANe] I!lt!%*(x;X՟gkx_=քomxw!,"wI`mN˟d7?43ʽ}[CCWa }VcFtgi+ O.K@BLEQ2uBj/2=)Z J!x_CtFjv>^fvm$.srCw<݊tHkq,]xV61L- gς/dT c@ANv̩  mAC$e#T{9/t|*v9'E.] B<\*%T8L{퍵 DgoZiLgSp b/.hUrM%zUR'G aV@ <~S(^Fp쏢= &Z} 6ܴ{8+gr@;K'D.G i \=\Kwt +pAt+{#~(ye AV 0ipa ͩǓ=tWăōB =mC[EfL!<[%3L&bb;8+㔾B kAn;}b{FfpƟ a)6ђI5IY7U"of􊍨@.Yo.M?#i ChV](GGDh« 2ޘxa)R7rmLe]_O'2d!ŋ Yj߲XeH \·\q?% )z>JnN,&9 .&}K=/PUH286_Nc⻅2$R]ڑVF]\ןL \h8g@jnDΖ^;‘a'!ҎFm+g!}Ixx"-6d=~Um*ękpRe'P'm$־ -i eBS6PTL,*J\ uf&@4wp9ӷ f~qWkQ[z EI$otWX4ARE֣_bsxxh<Af/;8 5˼I(񊰜 (#֏SfyML}Dx 1 P; &$ksA{^]弨 |۶e$C)ISV2fd:&ʞ+#Oz QrE韵XD4IT47Sㆢ#<<8b7/ ȡoRՕ=;<~2 4̎Q>)-)^8hrT3A,UeUyz U|  fqE8+k1o>pҏ3]tpLT!A_G^r?<@+8~{x/h [l~JV .P`'*k4+\AeZҁ5 ƥ/6V^}r"FCEVrbc @lPhNlX(}+/̢Ӈd(ighaxK!O6^jZ9]UtrS[oXG?r8urT]X5V4gB6(WiC"8Y֘KbWkNʋV2޶P_ Fa$ WhU<P0[Wa/GeD/'W=RM"K_m)ǠGV6'g#25K#q$5m.E(Dj;A wb%FL_92eUv}=\06'_5@ۊƴR 98(:d29-ݶA FࠈmCwoMִ4=-љ=1U}Oo,ܜ2m{)gRm6%MTAUK2x ͷPk#.GdAfEKe"B K\G*EM[a9Oy{B՝? 6-ڇ$Ü$tEͻrrzM+`uhJu>'`A=᪡ˆ eJ @z׃3pz2f~c?F ͖"꼘MK)Ek\ 'j8D֟\c+iq?&H[9*_ƺGc 䈿k"S>_x`ƿ"+T#!I_J2Tuz*I~d΄P#ȅXt:ȅXsзcgF->'S}l™6{k_@I}7ؿ,O=mC\GhzB= l$by/qI2]"x]])Q\&M \"_PszR))I0UQQ(Յ 'f`-҇;Ǣqv|ܴYX&b53 ,rO?X7Q% }%(5_i]*uaK2qf`qVW`j/ N|˞-ax78 UY襣T^E"%gѺm'5-D L@߹£iMZL B$8QEO =QiV3C0K7y=: gD-՞N:eݐRTgIwdf>آyJZ00 G{Tet ƌqNjpPZ/SWGE%u:Kp(AdB8(]{l6Xn97t٦-5fKR |նUf?KCrz lE묋1YflRc|fvQ91y# y"wq|Ϣ 8U W9&/it~b;R72GQ E͆X\Oo ED-n!NzeAvT5=SpQBd%I N^J"K6C~`ڱ FoN6_q~xSٻIH;Gmy8t\=E7+:5eG{T֍?q1 pTu$7Mr^BD죛ü)M*R5,Y>"l. KUvHq+5y"E@lHS<ܰuf +Qb3l]g=|4 娿NT ,(3@D,;J^\eMs)]Ph4׈-4)% s@쌕$50ҽ~@Jb2|8LU  }z -(!a%FpϢ]WqC$ ;bvk3rpڭF@X?Yw1 !=]Φ@ =TBߧ FƈW0S|fb\f$@ˇ~is*ϣO1IKѻ<=ttm3۪ۄydX4yQHܚtdo!={$ڳ-Bu%݂ӄIx,pAmt}ji_`:D?H([SRmyާuMynjK)ft4 ^b= {{)L9|t\fY]A+Oh $LS l ˉթѴ+8:&li)+4gV /Wj" Ŵm'~7B9Ua=ST7+ONjV%SRwbUhZQ6 V),ZZڗ:Q'iA[Q\(~7OJKG ӽsXc6Oۇz}-/E;@;HJ0tR߭k5N8ʫXP;SfKB"jI5d׫6 Jc9/8G#ţ㏅/7 t4S }4.^c!{:{}}sj~wHSŒ<+Uۯɱwbx__ټ}bq"O-*cB WjL/;.MʛbLǮt~aÖ]J+=.mxkTc&KlX+b|v|W'4z3C*o^G)@7H N1U=-Aڞ`27',X#p ׁ[FjZXgeΆmՋܕO UwiSzH;S4GQc&D ڏl# { Dm+.NդɺrXH{ 'yTP->AX3aX 唈ҫڑ>M{]b́ռ72Ip~_ xV_fȰ&H9u:t>xC!%UE-z mnUVG RSW hzd JGn >%.rKz+u`D g!Ǔ>Xなŭ4 Jh^l[M^3-C끚?ɮ6:ʕx4\V9)VG̑3riȇjA|u\3~< JT1 P}U|In[xiaZr$IUi}wX /?YԃSf>Tm8JQߧ%kwRӕ{+q&ļ%gڿcuZ$%U~V1R|~|*FD@z vnj2Ecި2KanxuW#&&Y`c]x+w Yon|â`DzH|;oҡS;g[}fF*'-/s]A]f =?%Bdiϳ&oQ\$k1jtm*ddU*yB}~cqެSN 65Zs-9yu ?D`7TMYqsg]|8UӮm K\Ks8%X u wp' EK.Na+Yg`W 36q̾fH[ZWǹlő^x,낆HΌ& ,o`Z# 7/ l9w \%Fڀh,BN׼BA0'ڜ )Td+)&`31nks3+/bASv3ΏX-CoRWQij6Ǔ!tG2iyAJ(و/3:cEfb>žU*x- > &Yԩ6$r΃ Ew: y? #'VDNO W1zCG:|tW{h*}pnO:fLYP&8S40f{|zPوY}? >$sGzMɩIQH"XmtKg & /o!vW{ ytEX7ANdt^R-_\ CƱGZ@tݷ(p@n2E!ԭF 9=&*ˉD3#whLBNl_If*U|ם-+N$Aj$ }80aaAiH5iW0+N ^%DUM/R1A]{|e~{@T+C=r]gkJ>3a@iI.Ag2bpIK[c} SM~Fiv2ԛ 0zy\_1׶s2mpJºDVuVt&tcZj\TH a\$ ZqxΗ)7%PvXU@_:LU4gɅYz{bTLFiG")QYu?FT$*|G5Oݞ)DVM 5+S L4b?LA.~KZ2"Xrm#"2MMtoUd+XZwQtQƨ'2v T@nj\`f؄uHnLT ֦vrBsfEinKM6 aNB"Z2 N"Sd!$ÒqkoX xW`ğ+؝җz޴毫o%yw_\ϟ(Ÿ؝f"Y,rVD *` <2MBMvYW\յ1Lv1:kƠ,_Jw͗/UCXO{8"%˻pEl}K>XΊs Kj[Ch~tbQ4+wcL:=`2g|IsMCz^i}C9}Do:V=ݼ٣Ν&]JyiǂŮb&sŲK@oȺ0{39Yn+z<-^~Mt|+ȷuiGHDҵ3O3]Qs97. ` ˬ!Z^$FeGʂ9dYq{&0)'^j8vzKkn?4݋V7z=3?q<*"qDDWHGV"`T& DL[j=z|S+aR2y` ӼqixZJIINJ`?1/t?E-j;Q&"&Mm2@Dgna̹NxBU~[ #j&ER`Is2|PvxXnQPH7sʗx[+~kn ݳ ~cLn q!lU͠"Kzp>˔87SAk.JN(___2عiY|dFYF0J׼jIm? =X fR_`z8kLL+Hh~NI" Bt&zLH4V#2އjo Tk"/#hH?16H9U]?^V ŬYgcYX4 yKehٛ1rq=cVM]֝}3Gt'ҷ]K[v+yaM][h 6<1RW6P㟇LyPLϸs4Kmպnd&z kmcӄ=I".;ܾkFMD~>挳l#]!'xD=|(XK$yA?~#vM:1  *=O0> ĆxƇ(^2 tW%pXٔ4Dچ=o˃yկZ;5xiz 5*dE#VG#ğ-:ҬY^\ݍS6`K!K`7:LfDzxʉ#s ")Ф28>+>w`oj-wAV: RPe$(^GnkWW݊Z@"FgZYx}*^AdNXsJ,K@)WHYUqpbd2PJ!]_KL"# /Jvh&7;56"9 l1)F#h꠯2ct5BN6v'oDUF9. pSO\tݼ]6.O)%|wL}'nC ]hK:MXenO ϩ"ÃfzK!Դ9f-:wzmhVԿh6c(xƬ UiMN:V3Z?:ˁ),8]ƒl;ma5kKa?£y odzZy9F3Pl}\̴`or0 A Q&!˞#T"q \LHn.%_h CGaL6+9rC%Ƨg5,uӎi.فi_$+JoatuKL9VE4`Fho '*l|+㑺%v5wc}ATxt]MGٛd7 DhΚ(1g=JMcmpLL973Xʠ@B[M'Z[LE_x XR=ޖ^Jȶv߉|׃y9:v}}?BGn[IE!g .ndtGz\^{RDhOrGf/s5 8ō؄zxE!(*r<{eZgex{[Ja9lmC & A!m+/|™Yxu[2hճ Pۈ?,WCܦ ^@p|Ȭ (괖ِ%Zn\}s~I#աNڱs>YEE sǺ*!_L"ϹnkQ_|n~mzC\HWN?&?z{mbߙHγBޟ'㪅Er@E 3)zqH“sĈ]KbU͂ O̍TdLs `qsFP! Mޝ-*}KH5b>Q/ۿ;Sls*4]/<6$j$p GP5D=*Ԟ(3Q6'"bБZ G+7XuZ9+!ܐDbWb g af@p'+ծUvj K\usc&qci[9.3Z^ɦX@3( V_$:!%vø%jZǐ/(b8{'TKN9]f8 u*A: E4b9" P$AR"1ѵ~/, Irjb^E7&nS4KZnWV렎h[5J >ov|W Nsuƺ1a՝3w<G>}[9$޹|?n-<Az ݋N`T-:c # 2/:n5¶н/!ώ\5k㞹&&5kI\6M 5CiEvZ%QiCW+bG czZu] B~e@t5@ @E{$sKt$Zo>ǞNi?;9OM`]ͷwsj,ÂpmyCB] +3z}zroͣ/ l):d}8haz"{T2VKH8dCY|ZyꤣͦNe{2Fߣi>~򨚰!O7Ůz>6qq~Sl7!9dڄ ?zR'qXe9)N (wct+Q*&tMgk~h^:=fW3D^%n4wqE\&A*_T3{&IYq l!@hvUB!] gK!h[}}.\ aͬ`RĔ!Wݮ2ǯAt=oX.#eYhҤY+Tt ODw$VWu+ AvvQ蝞Y'".UW$/տ"X$  C꤂:g,FeNʎ.z8pe/I6}jBwXSO3)ztc wN۽:n8" v"ѝAoW(ذ"fĨ4 h?W ݗ?ot@l_f3V1(B㕸08i{V'&,j",٣hD'=~/H ]()ұ=lr}N:hJ'8^e6S+Fnـv)]EύsF06'#Xƕ'^!v,KL8X@o!3>+= OA8L2Eqq%.E8dS ݖdJ0JR3# *2/ s\y"Qf8 tLfwT;?`Qd3ΝqK [*r~#ŷFDt,Id]j;y3RxXy4@Zyڮ=w*JG$y-KsDUՎ ؔ?D2{Z` @q`A7 ˙0pf9Nkk N/ 4ʠrT[ZHG d9;6W+j]`䃲%TrRgҝ0S*b|T1%ʢig:A!duҳęco`Q ڡ$`Sf2N=Jž`@ҧG~;Ru*d7WPaw{ĒP o*x"-?\n!h:APfXLjN{G$|nU "Ce#UzU=FXD.|\@ [2]C6Bit]7_d0w8sXD*q$8(x'+jt xB^ܗٳ nHoĆig -XiODN4T2{*Yq^R?F=N{L[!aɕD󦟬 0k~$3bm{Y POҖMdB QxxKsQ0E") 4Yc+ܴ9o16Uf%LQ7# 8-`Ezt_*/vʦ"+S17L0dt:L\A^ ZW3)qPR'SOQ Pdz q!УjYzqu {$ud lD~쎚)ou8_uܜ@8.ARTɗt-'0%W6xqC!߭I #XwDڥ6Y"t_GuC[@|cHl+IeDF_ߞxHkN.qEoɵ֎Qaa@qQ ;=Q?1,I2;?P/ CD:_4#-*bh6I}w7: ډk*W:9R{ k+ ( 5u"696ٹ O98EXm#֡7nR֥YdRN^ V[1]58$iO>#76d6~S)%J2RrF,2AvdR.Nڈ%SX/{0>_x%>)GZ9[<jD;GjA M/Z%#f̽U/:^ACQ{IҋN:} 8~Rv0]nsi[s UdzFD)ɡgm~MX>Oٱ2t5u/k..a4uq&-)eLȖ(Gyw|==QlF (9-}]Ml|;hX(T1~ .Lo%&X>ָx2'lLp^L[삽oO!3Eo6QTI{6/#9f F}Bt9@m:)K3KW`x4}D[loAMlUo&Zjl#!]EWkz9.]_Xx n#уfTvn>h %JGy zyys\DZ(^jj)uTE9b7ʓc2ɁBsB9|4ռV i+9+ѻ>ўJF +%QyȈGχEoCFT0pހ :l<\:ˡ(ǦKsqLk#7 *&UDLN &5YAycyhD-Kv]R%Knj d{(!?v )ih3ꌥeع!ͬPXE Дi]B $ ]@ b*ߧ 5hLE`!#aK1pbE+`kfƋ]th'# 峹"\6:^(U.%x>Z*?koUZEe0n5 EHkcaM٧JaN lhl&4"0uj~޼,N$Ng"T+C|ǚ˂J &bq^I5G#W} {?AD_ }ΨzMzlYІ%v>Z缮,b^R6d0 󍊱i$%}}GU lu BЂ7nk2fS Rx<-ʳɨRjy1\,\-RВ?U.@,ӗuC;w Ui_yo`esDN(r|ֵn54h:ڿOP Z Zд Z^qʬ^)EQ shs -Jp8<|ULjqrk6il68MmvzcÌfDB.a~Ǩ}~&I?xWq7-ׅz>&=?l!c*0η&>Ns1u1y 5ߔmP4Vz FEv c0SwӚ`v/`&ybuW#7!0yp $MWfsڈȼ o &>e$x|Hn+԰Oz%U\35 Iu:u?g_G2Pn1(/"J%Koʇ4Q*h}'!V`;0).T}PZ_jX-s"qy\*n&.iq,VkB5ƞFazlk6i/ViHQ N>u fnp "eQՇ YR0lG~WۜɊh^2Ϸoŝou~ޜ=e5 T;S> "|: UˍđyaGaFԽJP^L&3m~&O?_kH-L!q,^+ -czJtg2ZQѽ Ԡajz[WGu ;(KGlO^QU{ly0WxO)Ǫ\^.\N/ DVJqs;DmԢhL+!vmJ-piyFHMD-WJ!4HVTC L[>XB)8ݶꍱ~t [FĂ\gϡN[+-y (k^ )%&b SK?=I4k[`]1{V`l9 HJda"TRji)t~77buS>쎛~J."ˇ5% [& u՘>h<;2純qW#٨JzVXB{T;|;ގe/K%͖pT }B/N~hpռ0.jZϞcfBuB¥Ҵzw<}yO O]`7J8GgW9tȰOjIt>{F\]Sc.n"ڱɸ|%6X XXg6qʯY*v0z!xh?6UUzC`ZaMDvkVIW?ŕϒ.X.xͪ!DF\0*{1v:ފ4t!_F0x']Pf=M@{D'i3Zn |7Dp4ON΢M_CMz?K)(+bT>@=@H!Ѻ:l7'wx-eO3ShmR2aX?6GEQ66z*O7ntivu:G ցuAwwbC~| jp>,Y{RfԌ/õȀ:5r$1"U)]Ve+Syhwٛ+"IR^])?mbTOQb^(z_s>·ce+K1ۓ^AXBA"[okG4.!! '9/R>3jlpJKm(9ke" .qCUYBNa憬9}Od Kƙ2[evpO2$8[Ǻ7*mVsOD] =g;7S1yoaK8lL0~j0ZrE5#n%0BxݲG)fحxcXw"nPs~p[2I;P~/]7n+gy3 Md.jScJPN#2 ,j`(픢r ?R 8o_(x 9qHxF|-R&LtZ#@H 0%5ă1-Bl˨0q$  գS4gU`:% ^V Lu6 LfPaJ4Fo[nc} tW5=Fm-m[;1vZޮצ>!%_ʇ'^ýi)~x<V tE2)?ķSa7Yle%D2Wׂ#lId4Z^7*R%YgЬ#գN͒c;7LK J$8u-+c!ky'L|A7.w[T|ȁjLssN%RP JZt w Vyr] 0uWN#%G9`!/(!ކIKbPIA9͋wc}{x,;^mRqT)Nsԩm4A}'dK NlqLj֚ j6p*ܥ{>nZ}7ʈOU8BnSJ5ӎV g 1:+=Uk\Pi7g!993txqQg% XhQn|@`ۭkĶV5?Rν@+i gȂVt=S6yňGFtK/ r}q#UH7$F̈́2ReC":ctE!떎džrD4T՝C7AM00#F߅P8b  _b쭧\q(%,IssX*U8I(= %Mt&.܄; (C?0<}oOWh +7*ϗ\x4MQp|ѺGX#5E+)1@|'zǴ3pt?ڂ\BDB4&)3N̈9Qn|΋$+]~-bmbGͩlNbgԋ/0z㣌 ^޺VSo*vB} ש!Qrf,xx^>e@ * rc0 *x`#Nji[,8^)4H8pt~~1*zpǽ 1/H>`n(| [ehWUM3Z}I <{֪$~gaI5EJ+!MD| SH-$JW9X9C)( 7Fܡ2"QaHlr],B*JOs  qs4/>ABQGh.>X㈂)0Bj^_"t7+ϭHMN%۝8U Wi湕vQhz);#B|XLt-ÿuYH# _vtdBRyC(`e=i]YJE(斛XV'ӾStgmdϽ!E۔>1gݓ+_q##A\qB'J$ !I8KW H'lg5rgcZІXйK GmNu8( WW?]O"G2َV=5d..il'VF\[sCO ]ZMۑOϽ/J,ي*+S 1葈zK/ґZ-WCxFq[ϞΡ$M۾埔26=:G\h!@M qMhQPQcG}M_cٽk6dmB:@ /{xQ  y;b s5XjRzLÎѭC8(`lSYpֲi\SȑJlU{iRI#':fd"^>ڍR/MJ+ G&`B7!Y(WA'H## W"}Z*Y {hb."sȏm3u"Jc퉩 otsƶ&w#۫-Q`8 [uLZz]&${NU*%J#$]zR؝$ڰJkN->@B}a͆Oe/lh0n2" qMøs ڋKb>M ȁZ Mbټe%{1!0:kZdB;/ëbIP ޣ\} ;Z# -ȼ%]9$.UgfaWX6R^&؛:'nF{KU9j Eni6ض{)ިh OKMi>"xEYgk6~i`"ii)MPSLGJ6j9Z%G15Vވ+rr񊯨QNB VڸFQH/i)e(g$<@Pz?"\EUa~1!/ Xi<fGk)s'Hv h]@wXSnj{e ՑMkGߒH_S|x# KڡU*GQ*{fst.%8jiS&b糂 9i<9|”vnC^ީ|A; swlp{s8'T![C~"8|\GKh}S.vpP `9H#>QL!g$gwT]Q[yvYNqRNC˯2ߡdEIf"Jsi *0wn;Z6ۊ'WĤ lPc W%COc[3}UV!UÀDش|( ji:fuj8TS}M^!-z6WkCJ?>PgָB:g1J=CDc"DZ'@@W֧v&W4#luFkkK쁀1]"_d> ӑ=ڦ-ě8Z _>Cp7-wTB>h%F0==Шnó=_,rm00C>J-/!^y,8R)V0!!]R[n,֞6jݼ101m(,ɱ5i\kZگqj7}8'`9ܚy]]֚uW '7ϏES7a3sS,:C:}D6Qӛ IN7I:t|z#9񣥷j4aiNaCw]튴T[U mQW.Gw5⒨n|d6cĬ";с#1O|cnnv5-"e=ad& "Ceh;6n mRN{u6* 7:szgﻩꇗ43InLQ]q߭t ;yEuy'D1e9CCos :\}n]ځ#Hً^R P'AOK+@*VOٴ48@! ChD!}=ą ŽU%m~m6#΂R9!v(F5)Le3HVuIy!I!5b_U2Ȭ^~~jbsn%W2Ѯ%";DK!׺°M?liJoch(ܓ\c W\in s:xO@*_&cq-]zf]qEd+kܼeRb jQH,-?K$lBq?#<٨5xs:ߺ7 |2UF&]R*m ?Ij晱)|l{Dee!Cw|MB})ʅ]Hwƀϕ~4aYZ+W jyHx.sqEX (ks2) N#bb}#* [zEyqf퍅>FC`>Fѳa̤bdWm')^OәjbdBz,Z_v6L"s]X}0廦~@V$VIwDs3<,>rU#ot!斪 [Z4y p!$=dSQf^g=y905HۤO-8Gzeʔ_?t:Hn^}2彬cm+هz -̮4+%?8G%;y=[CT 7Gj 2Ap/ +v@d u.VQ}3ǀy$ Xu#C'["-/d\Dm< IO Tqz~ہ[VK4RSC|G3{Ŷ,I ?WsѤ>] ITg:<1wObIwm@B`Fg4u+GEC~,qO{׺g꯮-n w]4Gu' @#$$ jؚ{Иl&*ɫ7p%M¢d~+̟ܞ<GrOLXr3%/7bعVJYZE%厧~+,2*L+\=v\`7HU^)#f["~VΊ7C8EN3E|2}3 ٜ'XќZT{Xz P/MˆŃYzl!ܗ_!5c#CzBflFSB7>n_ߧ}yOC""}I;2FYG終fatζMU&+c@wOx7yղ"ĥcrD-e|8z2깷I)f77#6ppDm\ $2h4 Le3MpD~ѳ-݁֊9V*,DӘF=|)@Cn`y@{ypsʤF 'Rp>y<7}bMm'Qu'5/DZ2լkz^xUۙ*d:3 ,Z:2B5!rޚ #fp!,{ZWԈsȻ@(נIq*_}ͯlR8d5$Um^2_FTNP%oڋ G^^յ7Z;9T`7Z뒱.$S9KnB^!C;vϙw&R$Vb+bF[ %%ʄ&/z* U2#Mbn5˻A *ɲ% \ir||- 6Jb96.%v }|H{AK#$k8E:8+vpS]( iWۄKm,Y^*TOEUyZɤ]_q sk bXFe^} 6h4oGwΤܑ4I.[c2ceՠJ?X/ԏE\$T2?,oWFh'bnN>Цa70W8U< %v/"G3KF k~̚{<~SLQ.Gƪ8aSwb`M /"ٜ $!ԕIE OFA:okM`D(Xg;R=Pۍ"~;nMR5} 3I2V+Vl> qSb?]&'M2y>>7TN6A_ Z/Tb!C.>0"6?k}Ar KR>UkeD J+^K}+Ұgo#D@<z՚+\yx9V|zEQ#!1j2%2Q]–DHd>[q *T:sݐcLw*.JHSvL9mŦ\\8Ȱ ɡav9F65*;8'(5pnCpIg3kLP8;ξВxb@0XI&CO!@0g3 מ7EyX~p+739T]77.AWCd18FLP>,ޣ,8flRTsV'\/yfc5Sΐ]eVYU3DMqKBe~Fǧ4 uY9ŬI1ͫO՛mg^'npU'|?_v^{(hfY׉Kox mC %d(wl u"m}(6gRgx˲02xxJWW"SLiLj&e2.ˡx#,nIUGA*]!( F-iE\Ct勓F̑4 !%Rw]20[naGq1o\% fZ歲FۧdrrFcH1\?R*n1|o/(M& +{LL9Aq/WA7Dy!#RrHZog0pe)[c$P+8{ `iƌ)mF!LyoGQafΎ#ޤ"ٕ@>Onx?}>{ bW%}M9}%{ؼIa6D9=ylzC_(;qi뾒E$c1yT' 0tN)#!c/OoHfEBvk?bϕ'l'8LƢڷHMJI$&o_F;ꂪlL|8B.IS>EWo"z;S\iw: h3K;߱n=ZLߖM36`=#~`,SK& nRض.?-yR*^f}x9QEb{jʗYd6| xD% {꿅=ҧsZO? 픔Ѕ+?Ȅ _'q$btBO^NPsߡ p=~t0&ʀlP,u4`b #[ rZ"ކR[`h!iuGYs7Wc8ܟsW6%G%_ r۴w?uzuX9-k0v\|(\ 7Q<-s$\C[BK&u2-*ל)nvب$[#X( L) <"U,du W/tH5U7?n߯z+n`xq.=w7.Bxgs^fpj*fLQFo>i4rC*؟nH#(xy^(/L9jj'Si R^<'% #ǐ|+>﷛C=lvXߥʗۯd]OJ"ԣtHTXOU=sYi#7A&T3>t[r*:4ճ1% A-)ω!l|؞ҷdhBX=U“ JA.n5^N_F %hYC.A ɂjQ8ϦVcS*h%Y5luAP#a2| Y]F_6Bye*;ѢbZv[9#ѥdI2p_I:V ˘m0c˺ _>j~iF-L, ?V.:(ɦJUVX!3h^^#2f0Z70 4HOA_;V1Hުc[9MϨJk2͠]#j?ɡ$:yoUg*Ӎ"ʐD4nS`Bubo(cjŬO".8pL'rRF»n]LXMcIѼ͝?1m2c0뜋|DD]ͪhfxPqY M'#: x[]3~Q&D:f= 8aיkYĨ`f4撊KxBJIh6taP A͞CiZgǮ->D|h~,6v7L)9&,}ɳmxdnAշQM IA7&nҜT+5UrE2H\Ve=7^R@a_ۄ $[2Sƈ,T;aͪ?=qy(N)qdzU.G:~%|~e Q˽l)νFz+#]_RMAiu]8e2CD,k3˾W N֤c<9%xo*x݃g`Dp>g؇Ҁ*;+Vk>ߥsQ*!t8f!)>uN@7Kn-K޶^ =9n72+%\LsOiɮڳAL(>At)W0윷M31Rrlk<*sH$ٻJPUWo~czCVjzak]$ʫn"vď Z/t[/I5IXy -qyTl\E@7/6>xJ{J^. W[ۤw ïluSsr(s98W%lXT%vwuO,]tM>$/ۓ Y 1OO5U2 ,i.6Ga !o,I-%h@}ʹ8|`_"Q(VOcDis4-iO[g%py# wrrw>rFq\|V9)&fQm_S~6PtOnr\pLs޶S>k13($G9Uk*e7RvفvD^椨Bwgr|bLo]Iܲ XV;|2f0r<8Rq' Vz:`f`X.u?u*;, Mكu_qꔣWԚ;`tPrcܓZL:ίҥC2߈<яxom ǘ*>g2p_Œ 5E*FU2n[O@&(!լdxDίi Fҿy"XLWԤMTKroT*dZ܎;&K=%1FEYڗ-MoT~t%ǹ%N! } /͉8֜ɶlnb _>iXH_7:GF>YB ֹA z2;xnD"t)->#õvRKWsGzk*nQBpU\NTF?DnCr^tgmen\Z ޼[ P|'=>]t[#O/='!@(@I.KLE2Uos9p EJ;TytR䢬K񹄣j,Ӏ#5$UE #iy'K60`o͍3Da΢w^&L \.5*tӱQjD*f:*t'}w%d2-[ץUd#WV ܩDYN2tyĄ=;#WDAQ"RY^(p-SѨOE+i%ӅxC#cCX /h.$sAfYR?x'i-Q # `ڋMt=r4J]׉j6XM\bã]DǠVbOq/e)T| VoՒk>:B Y;#CD5:SlNnUsZYZ8:4XHOVz:q'huagiP@4[fU` ,jz_jȏ{W(ueXP +AS`4"]j6(AWa"`ԃ0 b :-:Yga-WNSUyڶlrBw@lBY^'~h> QH"zPT9x٪8aB1zԵ@Fz}^jp7͇d4bd8T4)prʶ5ϡ`]g%ʨH+ yb[2fiU@?AEGo}J<DD=k[+ƹCDzTZz?i JíIj-A[Hzds+_.71zZg[ڑᑗ8U}.i89̬QD?9<s9T$"p'p@ju2+VM!kxlc\N6v܁ސB +v'.6;g s]6Ǒ9FKF8hGfT0n0,\rUS{ݍ^K7$"dA%M4y՞ThtDuGNIi7$80 e&ZW*01?xwD`5eD+v|rZYX}i!{vY LnbʘǀkSw1,z(Dvv=7î[Rݒ#н<ppl;YY^dT{k ?a3?jisȑB*iWz2,j8My4>۟S؝@fYx,^>\2M%%gMZf5' G:| #v=V 2\swq&Z7|?.e_= " 1Ԗ u ߕِk K), KnțbvOD`ޔvy<}#{aEm %N>CQB5y_JǼSNl˿AD|˛`/P۰]& 5Ќ-BK3%-Յa\|SETC6x?KrV| h&'X'LЪb38Aƈ]a Tza& XS".SqvFm32AP)HT&ƒa1fC⎃.>sW݋@}^]()_*:С<=z^Q4Zy9hf:aOV+jz1 rtmWM;]{xRU6_5zY5QB /=CJ!Z4$rACDVeSY֏6Hv-rwg+&r dq={x i;ء#^Fg38ںՎ_ĭ+^$RpqX>d7 |1j0@d .y{Tn=#aC~z>n]QIڐ,8YMJc5k(vL]rH5+3*,m7ÜLf[3nwld7φε.MhqFvN9dcǻ7LHXn.\16<9ӵt 鱶E6[ ty57 ,Pz,XV(h4ԾͧOP[*$w$?ĥ2F`qc1|d6f^4E/iVlC Nm(D3̌+%-C`u&XP=`  h&-:FCV?Rΐ7 e@dz\UB?HON`q$&2EPR!xߦ*Yx8OKZ6F{8.Uh3q>f. +{@geLv"KH>5!G~]߱/OO6,*|Kq 1fҭn3BH BNw1DA;A %mhɃ]"X.mc-ʱ54LMhTK a"=f|GZ$wc"Ԩ`uELьǘ*T ;6Gt8"6AK孻r<ɉN!oowPi.OWE~0> "Ɍ2͆ 1x~GpKLY(h5 *82Y`;͑gG-9>FlԗT&=l1JNjPS6[#1Bh 7Ec1DXG0A|:#.6GDOl' ! S5 ܲj cNpI7|a$isH C \WD)U+t?Bs# TwL:A8Q/[]v"6UGwu! gXIg>}(oXl)E]b(V*|ʤgğdu^xZ&VEe&9[ݾ1̳oà<|$K3M:Den;zkČi ?R[ۮ~Sb~s{#}[XE?JQr9)vo!|ֱ9" z"7˷Tbc t! mf=ZђtZgd Ϸi"(Cӳe3Õ!(YˇߤQqXFmphvY ͔1w~ǜq:Y$nz,2xp).sh!sAFQ⻈)A?TPêw4ֱ|m c1_e-QkIJ k kB=K6  FgY.3fg O/>v5SLVbHl gQp*o0#)ٷ\Tmii'՝PGY㗔a*a~"e7h Gҧ#w;uj6\@I*īPC'ԅ]N<-ݺX r)[ԣGyJ [Jڌv*j4bGC_GXsy G S[@VAFF[zN pP 6^*c#T^eB""gNc6Jf0VCI͡TT]Nd'p$MB7#/jc􊏢9?wjXh~\>q i幓t393]!5t }h[3$|&>M-x35cRL#d nb&1)=S= xlsD;SyODL~LtgEjUuqS@\UԸqk @1ҢFTP/UMP7lev}S&Q (ʗ"_,j-KfS(Y,dJk4Cc] [QS̪&%DdK:+tC!ARO#$'P bʰV2=pb1ܬY&#%gATшL*h=L۔(GĻ)VX3“pu8ܬlc)UfFg ; UQ%F;Q/'ץZj8{Pia“p؝Y4c 8~bZ5A}G?<(W0=5?2~ IetIlac1~WL W7pm9y5{pZ bs!yTŻ+[b 0&L-q N@ħ/OJI2I{CNnI|j7?4>Urf> rKrzƗ,epE%ú*K&eg&abK2ElrDҰs.;iM%P)ʡFaS&xB!n6-} `67M=&V#fp_ͭ z~u%a_RP9SD+%ak횼N_`5]O kY(B'bR\2Od" }C+݁BNu^j鸍ZiskNeOZ_EIxu_U =y l _q+Fc#{C) n"M_j^UPu (=?HIK%`t~j`G&:gf"1S C-p=iJX*<"ӫc&CSZ#UӸnb A3#3x*wSdSn3VcVuSuf%7>p}6T `xG$T.Z}wCl {+6|OCfM]BoI0e*#?PfT]}w|Wˎ޾~^# qDKP~兩('?ҽTsN`N{IB-1F4'xjA(irEަ'Մ50< " >QuqKզ, DqO?*F~GR #~ }y10IKfR-z5o='tϧ(|v.fAJXNx-#'?*fOVپE*ߕ4d^~dTim>V6׹d kIӎ5S^(ѱC>U^=FlIn2U5g8?~c ]:zz7Q10sm%Hl((>7M_w2w20nj]HL^6(kW|:hWҠ<}&~AƟ>hagY-p{7 So/128Ul띍fޜP諊 o7!X9g<8))|ʆz,,J!AinWAj,n@nYk&1\+#*Erk#Ha(~ r߈T!"NJ*s q{ˆ1Glpg+W$qaXlcx0Vr[l وUZt/ J4 qW$ =UP\5EQ]a<ڔê]v% q3jHxck 5 <+U8YDSҌaAܗ.o<0ڊ&Cn$%)tlV~V8eI]/uƼ^H|{/NdB3{(.65o$}?(ƛ"x[Cp#xmWϴd8.]{(2w*u^99U}ܝj_hR|Wnۡv{ @fZ[=Րݼws^høJVv&%K>`Ѷ8X) Ϣ? Q[)t/HNC'|*)p ,(:dEDP)0e ݾۇ=rQБ.sS;˻!<EF]v(Pd:7À%)5ͨϏ;V0JHܚph-|KpK!qX8Xќ;RgMӞg[>dãp6qvZNnvAD(/q{s{Um<J /:x7(+ixed#iP_QQT^,x-;bu5\Rcp=wd#|wI o-g5Cqx_I*R0] 8'@7EK} Eixb~хF e٣W E;L+ݽ`/K{]!`|:} VnaW:94ō J™ݯ h0 ϠNׇ[17NG" :w u2pcRX-n~<4Yti0pOԏpw.5vQ%Oo<4| ?rň}y,g9aNً8_~V^ aWgjv.;ԭ/VjspD2 *Ѣ,0zaЛx܏NKD&f33vwIj݋"1فD1@إk+uAtӕ ev፰ɬ~0raIݹ;";De뤦m?DK24yQ}9BHsgm=:@J(є8t]?G_p9BK9vl}-FUx⽁l(:%t PY>X/^4D:Q4I`abp}q|\/PCa\-( "GqK[\h)ΛQۭj}}H5]U+R4 }8Jt4m׼M ()iFtRR's7@IKDȨ$[fdP#NmB坦z*P uYjb7O'y>O0ZE(5)yPwVxKV ޛޚɱpo 3C~^ lb%Csedߩ@K<ĢkmzT|Z[;mSuU?&9BQ0DC;sYy _ zGl-lȆPpC?NGk}"YnSRh;1!7G#b3q=оZ[0 ͑b9f8ߊ3Pjҷrڌ[k٬0b .)`Ft ^GxIJ:qe*PRظiFI g[_0gBU\ܽD>Hkmmb8)~CR։I([.t[_>˞s"5́>[ Aň!>[ -#2 -ٲ9S- :S I:0l>zVJg>!ݗ9/15;2R._gj3̮jR3=? ɾS@-hSt㽬ZƤ,i!h {.}<v`Y=o V'! U4-M !:_@sʶK(\(0b":$MFhGC)XS{y&α4fA5ӪRI^& -R 2_&rPOKO'^('5^$ ʴHdkޭz^8| uS 'rJr||$V@d~c/z @@@D>́ԜD~'c?jNBvh}u ١!lLT0_qD߽1${L&|v 5 fm(~ϵ${:ǹศ@e-8S?Dq"eJ$ܦi2h,D)l C?|ҋ1KvL¡cN%Y()'hȪ+DaN qt8z0--] "XeDg[<-e. (GXt}l8$olH?vD|dAH;6,#,z GW\)IR|%} 8.*t7>wt<h36A‹j_!{XLj 5{ /|re)/>KbBEu6U;;{kTxt[ hlK+iͯ9$eBCï`}V#ߐrrT."ؙ݄'qbw_mls ܄WRenvlwn{q>6c mVP l:&Ķq"/ 7_#3kRA0J hRBUahHvUuV9nn @ɨ*ulz}N#E Wg+aM׈$x'6z8T1Wx*C Z&JT#D+t B%ש?s Qd&ӆsuT:MEf!p` سO'8>4EwYs|kSlL:& _*Tc `!Ԯ]@g fTBICeB^9O-n-0~0*"1G >WecVRY'7K6§ꑣ@3Z5R`86b%<ֈSG7ꫬai$Oxu?\U;bu>.JDTNh[BGzGM@oӞp;)kȡfӲhPccÜ24-tț ?s@섬׷L%.u%Cimy#]{i3H*JsX_],"'nAy2">9\Olm(.I/?6'7n4H\tGK%ނ҂1$Ի"4;S/#DQW~PΠ<>sºg×7:]ӆak%nGeٜԭXB]@H/v=w9R~}^F}-y 1G7Chc>6=NNjު#`ң N?2`Inu$t : >d|L5KAXB!XCJ@0{ C| x<}tWRW&-7ԣ|  YuZ~逕zuI+4EhͲ!':ZոhnxN%=Vpa%y2eW!jqlJVEZ[rm3!R09\F~N 1xA/z3&'UX7gVCG1\_*yEXŋU?9Q#Q`+ǣU:uݠjdd"FȤd埇owL /8(;'\|%0H5 6~ .m8:--jL ֢.a6 QjTyFK[BeVw­+K+FIl^[zնeВ{cC/rRvπNrTj7?RL%K\Y 'ES A^yP=o!9u`Yj9$nJd*\ivj Cʍq)G U%*zwkiʉ-p3H-%BI踾D==hd`YWYI[xQ  ` [(8@7}(NpϜ8w_ۆjEj~+̙2la^^XREZ<ڜ~ե<]C`A]9o:%O#/R2Mx.\%_~}El>^cdK69UHf&+"Vk¼{L K lO2bOҖp..EI. Z(5&"\P8Vb!OoXXWj!.94g] B 'q%eۺ.n6nF')GhKٹ.uFtx CLEUE˻cO';.we!HFB=k|@iZb{iXe-=R`%\tD[$n8t]>dYSK 8׻ev&.c'8G=HSJTntVc> m2ϏE SŒH]`HWu݄NX{'0trd۟֊(Uȯл>Bp[߸u%GBX-i%andF&TvȀU [BUO/>P`'Vcx$tcHa UՏ((|bu&dCG;ҎyW<*Hf[MKǙX_앁B—$|ˎ҆6TˉGSTqb!r,cP77E$Jv^g JIȫfä--oXK0nd͗ Sx)üS]RebZ: Q-Cawޟ L?vP8yaPMOƤ`{1#Bq14i^1?-T;j;!PC჉WEa6-qcօK#pHhEПGs@A<) hL8d{F^Tj`|c{7c#`آNPΪ{Lރ6Xr&q /dž 6n&&%~>%}&k 505lSE!킭Ijžj2Vuٸ12bPǍ_MS1 tU"61kxeiQ m15T)ڜtN,!ԿSiɏx^̘YiB1F3Ҍ4nfMU(5?j6Aq#8u$,q9Ozc^M^F{K0 KĦ78bzW&BK^wl59w}wg9}YNdtLHȮoR:^lxPfU )M޸aI[EF"(rxKWxvt .gQeC-9tfn1O K1޺ s׼ nƻ P߈u(Ò^[^_li}lIfmQIC^> 9J2eML laLB_m ˗Zb֏45:hkoѩw.ž;AfظS)$VװC ϟjzj(<{W8X\2B#訠y ]@F]-kc+{{/NjG. +?!/m^:*KGVi$2Ed+PWi7l}Hc8 QR tF8BXYXZ5%(e-A}\ϒ78;* d&`ڏP~'Ľ `z *PJUQ q\\U^uQpyD?ˆ|~Rנ6sFTŜapLrW+tNٹ}yg24&Մ7Y6 1r뜿`v)v{ǪƵ:W1VCqCRTshe#Ǘ\M 9hmcKѴio_~H{$G#q fsnT)3{)fzn'K)H"WL_*~`-H<սM8O_:-s_+7 `ׁ_-@;KvFpd:- T"CA=W-C$N]S^Y\i#YM}h:;ANԤ jxVqgp!o)k0h]DύִcږE|HrL2!N쇣=r5??NR]*y٣W ɉx3t5WP3ȅ2('EPHg*\`nX .ZZ͉h+/{B7 e f]}k0)b9(FXAhT3?յt'EpSJݪBvH>v@Ḱl)zL8|fE=Ն^7LbFH_|l iڒmxMeUF`_v`cM&7ghЋG63SLKbP#ii i_@J̄$KVAVuC+Y. I{ g[)gGY n XcMmՠp7[LV_,)}3 7E?QS/lhh"X"ߗ䛲. 9;:8xhAČ;1=߷>Lb?,>zZ@!%lޅZ#%6FAB^7FC#pxv3i9d-r#˜{y\+ZoGXGTT k6G1/VxEhC:MӅgW_M}}/tzU? iMwQ?i$ JDB~VWsG1m{au(* ZC͛,u"&i÷Q_ryŮu >57/P=:j\",03CZU}ҧp N$@v"̻KIyi0H϶9u!smn[e4LϾ=Lޟ+~4h}U:`9n贈^GrC)\6 )p)vm7Vkڕ!zn*>hZh=0/MosPW<|y SjIKRVHoy8[m #;9c*gR?y:m[@_^ޠHw+QGcZUFOk!{Z.he-ZP+0kUhla1~H@ᄛ4yoI(h"(2@m6T [w{%*])FcK2<7ㅿ(/֯Fތ^t41V*r̯{ 4I HȒQOq"^ja.$%g|-U#.Br ߿u $R.<`樦$'{ת ʼJ%t[?FzM `_4E?^^_BD%m?c^iMqGM"Ri窐ZM:OCv;a-߰"$dK*J-q R4 QS3  YxB D4PiEx~߬ll{JzZ ̱Up!`O,.0(}p3jfQ$Ҕrx{bB&* ʮI<*'aS L<.15ofz~+a.胼)qK)ڏ-- cj-˜qpϦHdSwO^ۆd=bQBJ[F vWzu",kbdHDr7TۙXgy#1å#"|;×>CrO|m-=pЛѩSdiې/v]~>}AT4K6U;r-kW+T{ *9c|VLeu=Mod_ , ʨ+$~sg鮬%i7$ )PR9hGOX9Qn -P]iͅڏ1s3Hc=j@ +oS=c mJNI7kɠՓIV߀_g{ŅR[:*v[acŦk,Bu+wm{L ½xpL| ~6?ui˫@;dY!%SAu9<7$S5hG T ٬}p)s14ȱMIfl0ή^m_,AQӾBFnWInem2a4A?,-Ao ZATƫYb_<yUa6YC$Ld4V͠im#0xژC17GŠx[9k+t@Gİ]N>gz׎:< 7F7aW6NyTܮdpT'mi5,SJH!>x`G~sh`Aq>YMPѴ{\vSZnԿ`XZWaFȐh$cvf%>41S7;V,{?_$UiU1{LڤlERD5 vN)VV ȗW\fPߊ$.dՠsiDPW%~!pRW}!n>b^zfJ< D_'@״XMԛp<󼇕 :Ԯ7"59et׻a£a p<0=+ ^N5hc];V">mDkR(ccs2{$1B {t3eI+>SU1qz(2 ԠLm6rfwsr8x`\ho܀nTPR/CD6LK4}ү9Ϛ˕";cmMy/`.qq'dwf*r#Ae.*pZwe0h R8{#*dF="R!ޟ9, BCP,E*g8豦1ZIVpqie)>>bZ }A,2UPh6?**E1CXphvLJ/-\0? B|j7]h YU'a׈~I?2`!Wo6a\Z!"|Uc-һ/*]<Jd'LAʂGdMA? *XXOPRV57*!TR)JmfI4S-RPV{9<.BKPl"ՁTNg JÎT}<Ѧv'<[7y"p Wrg)+z)2u9|yv2T2؈KD#Ϝь͝&䝪^lA쪺,[6C*+d D ?FChdȪη-ޛ_n6٩blHh]<ѫ"FA{Tg?wp?gro (Mv`2٧Ē@7q ȯd\+cUuho\v..9*˘6bC܆.lH&e7裝SYӐ?YMoGc(A7!6J #4R6̄ t9U;bph1D ~(&U74ԪYrղy[g?ދ:o45*S\|(7Y&"'X`3ȸ0DTj*TM|$~9&4>~%C}n{,J*) OI t|i/*.0mow73J94 H׎~}粀>q{9^C@ MtuS.8eea37Uq&jGXl 6^zu A>5TX=?)J /V $E)R\CAS Ud,$i~kN(< |# WȐ]KHGuJzj2uY2 Ol1o5hޑ4v;nãP41Hi:LRџp,[o*`Z}R;\{6"{&مZcvFuEFW1鷬}өaK5-邏5zJ6iN`'2JlGS3A&WK3qc 9K|LQ,\Wɖm9"I\Y Hݦ1{ZN!JzXusC[fFR$bE\;l<|u&@AkzT4QƐi'uԳ (ZiTu(2,zW=lt9UF I>lO$l=/4q~k2/i44~'M6^⽳c^38'Y0ӸI#=5*9 i3P%ƫ֫zjɡz?|NޭG{2rI$5Sf8" |$n9m>f h1ņ,.-&ua5k"S-ԋ ݑ>JWC h敉k}9FG4X~҇10nL-(D#v!pGλ5rw4b1)զ OO*@O,~AtEgg! ]}`{zIRslD]%xh#I) E-2ϒ.$ ꋨ*4# f t|0v!73Aއ\;aX@?EژM[G%{9>"0<|~1Y*Kձ2'lDm^,O/\n81Xc]V V? ԉZ`d+h1'W8P-6Ώ9ؾogfxj87ɱNCvJ́=(jvXrXRSKwpۚjuS&%frw:8HlXnTԗcس6@9_Sʇ0S6b|to1$3R孵2(] kOfzǻVsYV`Ϗ3{~q&X}5:3nG r9F# e.8rS*EW-K11)&j oi CHzV”v:Y 鬵~2k¾8MSx^Fa[ixb RB<湚 kɧt#s b9_g5?ʨ!Nmd 5'7Ä'0hiN0. :LykCv4~Kǝ2:bui`Mh W<;NԲ$Kε[ϛ!g ftR2EJiP? ? L*uSH --Jic&1:m)-  s)9E 6CgM7U)tC3 33.mTZKDS?06|xyT0 36:f6+C`v{ C\-)^k8rRd*Y<A5cJ2asr%9HгeXqi6IcmLdvEdmU|yVo2  I,aDJ6ROc!<|ϫ|ׄCw@Xi{)* xin,jOx?s#nKW#Vu›lYWNNIԟbM'm()Sho|r Z3YŅbZ!G(bgF{2+6 u o<%ahu6+ى65Ede /C˪B}M|(ߠ',$WoM逘 BssI$LH$4GA|p(qk9_4W1&e蘷٨8phGv|T\!d Na`- G/U&" AX4a^nYlUBN 2@3 r4ߕQsD75&(µ[~T@, Lu嚦`$YMJ}x?% Rgc j7ƢtwJDm#Pp5:شrڑ%$gAx#pyO~ځGJiXC@=T3=\ɖ%eVrvˤ;e7ɝE۠;/r+&Ͷ4E9}vdfFAoc fI꯽L|'1ȬUO#@w!rzـoC|;FrTqH&}ҡ9q3OԹudڎ|us5ETLzٟcnݏvX{M>?^5޾0͐Z" HĘߊ8gҜPӜ=@x<w9}`_x޾8Z lW9wv?hjWΤ/4 v8M-vm`Z) ZD sxL1>)E l< WpT%-;U*%D"aZL"6|ȭ~[uc\bf!3W=9}8l:8_Ze)&'m`u2N$)l8cI@H:67~L1)pҏƑ F,98'sk{NXΟ9,N.2szcvp֠ɸ#%\qbD؏R_ Mp*']Cd@s8A$+?Mo'f h\1S{r/2!5SN*?̈́>lLGg)MP\9|!g{f7Kԁ`_om+`dZۓeK}/r-MWt I-M~7a|eIKv2Rg]13|Hh:9[E-r1+ӪB }8t 3V  DmH|6ܒ~c =ZH!bnj ]̓rADi{(i T70whś ,dX|X?)"Y\+E/zӘbIX#\k%((F/79<9&81J!z!8ry/rǂov+3`Gs6`hQXH鄪5 2nA63Nj7\Dt6sHLڎ۪ۛh=F T3#f;; A2ШUl̡.1P2Z$G_Uuqb3L6m#PųeΒ45 Uk)WЪ.]~*eA|P눴`37"fct79Ӽ,ZuP;g F*Z}Đ;-G_/ĆQ9zH' L ѪP'_x:zb!maLxGHuG u%wxB@%ʂHHum/ ӾmFWH,ۺev AwF߳pZlf2DK0 (4@uFt8j)֘b][G-k;0\3jM}JVVB_iV֬̓pkpMͦ@+rz. Oή8CI-%&T/GyH7+٦?} P`HA)jnHW&@o\[{sd2D!-4\/ y)nܭA{_/c8Uܒˏ e z+8\:TI SXA qN-[m?߻@H8uJiӊ8sҐWM+R oZ F8L2Ma]JA+0k轝V&Yͽl a$v& , M[ݷJ+0KJ{6I.ҖJaNTF9-(@;L6ؚ4)GOX򗧫E}}ްf}tH/iRh_ڢ;!1wMa<`jTN0]qIjyMזT0=9OlDi4KB.5 g2ucdiyhͻcn=]#=]DΣDY!Clt%7AaYK(L(/vuA``Y[{R80> ٱaDmM c8Ud,xA1ffEx1܇r=^ꦗe2dLY_L DwWU}xҠ#Z#=:up[PRmlY*~g}~a\5K{lPSsǢ7`4 Ҋ\'Xk3AK8l'UhV<y ] pL~PʬnJ oys(NvOK ׿kxe[u+}yK${q.BLgm` -I,Arϭ^q}ti0Nq33gEVXoǭN}x[m#xL^ \ [V]K&S;˪e5kPpnAt0H&]Eu9_],;gi9iPJ\2$exuL-M=<_MFeVɞF B7iƐ8*Vv (aG -j!ܷf\XcK%U/qӺVRu5@ 6-v`h]'v;㵄vi)d;V*JY{r,mtJ^ (P h835à ~_ YZ